BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314F05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 25 2.0 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.0 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 24.6 bits (51), Expect = 2.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 86 LWPEPYEFIIADFYRTLPDDTARQGESSTPCERLETYLAELYA 214 LW + ++ + Y TL T +S PCERL + ++Y+ Sbjct: 541 LWWKEHQVLYPSLY-TLAMSTLCIPGTSVPCERLFSKAGQIYS 582 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 234 LEEQVRPAYSSAKYVSRRSQGVLDSPWRAVSSG 136 +E+Q P S A+Y RR + + + R V +G Sbjct: 590 IEQQDSPQLSDAQYGFRRGRSTISAIQRVVDAG 622 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 353,452 Number of Sequences: 2352 Number of extensions: 6785 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -