BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314F03f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8I5X9 Cluster: DNA-directed RNA polymerase; n=8; Plasm... 34 1.7 UniRef50_Q5AHZ0 Cluster: Potential mitochondrial protein Fmp47; ... 34 2.3 UniRef50_Q83DA1 Cluster: Conserved domain protein; n=4; Coxiella... 33 4.0 UniRef50_A0DJ74 Cluster: Chromosome undetermined scaffold_52, wh... 33 4.0 >UniRef50_Q8I5X9 Cluster: DNA-directed RNA polymerase; n=8; Plasmodium|Rep: DNA-directed RNA polymerase - Plasmodium falciparum (isolate 3D7) Length = 1450 Score = 34.3 bits (75), Expect = 1.7 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +1 Query: 40 NNKYNVDCKQYYSTNKYLIFTKISSYNF*DISHNSY-TLKRQLLETFVVLLLCSYETRVS 216 NNK +D K YY + + ++ S F D+ Y TLK+Q+ +T + +Y +++ Sbjct: 575 NNKNEIDDKDYYGNKRLELAGQLISLLFEDLYKRFYFTLKKQIDQTLSKYMQSNYNSKLR 634 Query: 217 NT 222 +T Sbjct: 635 ST 636 >UniRef50_Q5AHZ0 Cluster: Potential mitochondrial protein Fmp47; n=1; Candida albicans|Rep: Potential mitochondrial protein Fmp47 - Candida albicans (Yeast) Length = 1179 Score = 33.9 bits (74), Expect = 2.3 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 2/43 (4%) Frame = +1 Query: 76 STNKYLIFTKISSYNF*DISHNSYTLKRQLLETFVVL--LLCS 198 S + Y+I +I +Y F +S SYTLK Q+++T +L LLC+ Sbjct: 963 SKDIYMISLRIFNYGFTLVSQESYTLKTQIIKTLRLLLPLLCT 1005 >UniRef50_Q83DA1 Cluster: Conserved domain protein; n=4; Coxiella burnetii|Rep: Conserved domain protein - Coxiella burnetii Length = 494 Score = 33.1 bits (72), Expect = 4.0 Identities = 16/60 (26%), Positives = 32/60 (53%) Frame = +1 Query: 22 HRQSLINNKYNVDCKQYYSTNKYLIFTKISSYNF*DISHNSYTLKRQLLETFVVLLLCSY 201 H +SL ++ V CK + N ++IF I +NF I+ + L L+ ++++ L ++ Sbjct: 259 HYKSLTFSEIMVQCKHIFHINYWIIFLAIGMWNFNSINPLQHFLMFFLIGIYILVFLVTF 318 >UniRef50_A0DJ74 Cluster: Chromosome undetermined scaffold_52, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_52, whole genome shotgun sequence - Paramecium tetraurelia Length = 1841 Score = 33.1 bits (72), Expect = 4.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 49 YNVDCKQYYSTNKYLIFTKISSY 117 YN +CK++ S KY FT ISSY Sbjct: 999 YNFECKEFSSQLKYTFFTSISSY 1021 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,431,658 Number of Sequences: 1657284 Number of extensions: 7963033 Number of successful extensions: 20002 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19972 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -