BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314F03f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58045| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 28 5.4 SB_50070| Best HMM Match : C2 (HMM E-Value=0.0025) 28 5.4 SB_53460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_22613| Best HMM Match : PPI_Ypi1 (HMM E-Value=6.3) 27 7.1 >SB_58045| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 1752 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 383 CLKSPVRSSCKQRPKKMLCSKVSGTKTAMETKL 481 C S R++C QR K +CS+V A++T + Sbjct: 1466 CCFSGCRNTCVQREKDDICSRVIDLAIAVDTSM 1498 >SB_50070| Best HMM Match : C2 (HMM E-Value=0.0025) Length = 111 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/43 (23%), Positives = 22/43 (51%) Frame = -2 Query: 262 CAICRTIRKETSNACYSPLFRKSIIIRLQMSPATAFSMCNCYE 134 C + + + + + P F ++ +L+ +PA F+ C C+E Sbjct: 69 CVSKQAQQTQAKKSTHRPTFNQTFTFKLRGAPADLFNDCVCFE 111 >SB_53460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 27.9 bits (59), Expect = 5.4 Identities = 24/87 (27%), Positives = 35/87 (40%) Frame = -2 Query: 307 LSRLTHVNYGSYKVRCAICRTIRKETSNACYSPLFRKSIIIRLQMSPATAFSMCNCYEIC 128 LSR V Y +C + + CYS L R I+ +SP SM CY I Sbjct: 26 LSRSLFVCYSYLSRSLFVCYSYLSRSLFVCYSYLSRGMIVYYSYLSP----SMIVCYSIL 81 Query: 127 LRNYSLIFL*K*DIYWCCSIVYNLHYI 47 R+ + + Y+ CS+ Y+ Sbjct: 82 SRSRFVCY-----SYFSCSLFVCYSYL 103 >SB_22613| Best HMM Match : PPI_Ypi1 (HMM E-Value=6.3) Length = 120 Score = 27.5 bits (58), Expect = 7.1 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 423 RKKCYAVKLAEQKRQWKQN 479 +K Y V+L E++++WKQN Sbjct: 17 KKNAYLVELIERQKKWKQN 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,703,302 Number of Sequences: 59808 Number of extensions: 276983 Number of successful extensions: 692 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -