BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314F01f (484 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0532 + 23711530-23711755,23712984-23713093,23713204-237152... 29 2.0 11_01_0340 + 2534998-2535660 29 2.6 05_01_0266 - 2040555-2040722,2041248-2041349,2041461-2041958,204... 29 2.6 02_03_0159 + 15822965-15823284,15823314-15823946,15824016-158241... 27 6.0 08_02_0634 + 19543767-19544057 27 7.9 02_02_0348 - 9233032-9233154,9233233-9233311,9233387-9233511,923... 27 7.9 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 27 7.9 >02_04_0532 + 23711530-23711755,23712984-23713093,23713204-23715298, 23716092-23716153,23716236-23716277,23716614-23716673, 23716873-23717010,23717333-23717374,23717452-23717574 Length = 965 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 344 WEIKQFLECAQQQHDLSLCDGFNEALRQ 427 W +KQFL+C Q+H +L + A+R+ Sbjct: 408 WILKQFLDCMYQKHPRALITDGDNAMRR 435 >11_01_0340 + 2534998-2535660 Length = 220 Score = 28.7 bits (61), Expect = 2.6 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +1 Query: 40 KPSTSASKESCSPAK*C-TSSCGSIDPGY--DSSSTSAALAIRADGCHGW 180 KP++S+S S S ++C +PG SSS+S RAD C W Sbjct: 57 KPTSSSSSSSSSTGSASRAAACERKEPGSPASSSSSSGGKPGRADSCERW 106 >05_01_0266 - 2040555-2040722,2041248-2041349,2041461-2041958, 2042372-2042479,2042559-2042753 Length = 356 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 255 AASQPSNSKQLLQLKPTINTRDSRLKDHAR 344 AAS S Q L L +N +DS LK+H R Sbjct: 136 AASAKSAQSQCLSLLKELNEKDSSLKEHER 165 >02_03_0159 + 15822965-15823284,15823314-15823946,15824016-15824161, 15824354-15824875,15825169-15825275 Length = 575 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 344 WEIKQFLECAQQQHDLSL-CDGFNEALR 424 W +KQFL+C Q+H L DG N R Sbjct: 279 WILKQFLDCMGQKHPRGLITDGDNSMRR 306 >08_02_0634 + 19543767-19544057 Length = 96 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 100 CGSIDPGYDSSSTSAALAIRADGCHGWWRS-CR 195 C +DP SS+ + R C G WR CR Sbjct: 59 CDLLDPSLSSSAAGKQVGKRELACRGLWRGRCR 91 >02_02_0348 - 9233032-9233154,9233233-9233311,9233387-9233511, 9233597-9233734,9233802-9233993,9235269-9237209 Length = 865 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +2 Query: 344 WEIKQFLECAQQQHDLSL-CDGFN 412 W +KQFL+C Q+H L DG N Sbjct: 273 WILKQFLDCMYQKHPRGLITDGDN 296 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 13 NHASTRKISKPSTSASKESCSPAK*CTSSCGSID 114 +++++ ++S PSTSA S S + T SC S D Sbjct: 221 SYSASSRVSLPSTSAPSPSSSTSTSPTYSCSSSD 254 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,267,458 Number of Sequences: 37544 Number of extensions: 213988 Number of successful extensions: 681 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 987904180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -