SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS314E12f
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier...    23   1.9  
DQ494417-1|ABF55368.1|   42|Apis mellifera telomerase reverse tr...    22   4.4  
DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase ...    21   5.8  
DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase ...    21   5.8  

>AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier
           protein JHBP-1 protein.
          Length = 253

 Score = 23.0 bits (47), Expect = 1.9
 Identities = 10/37 (27%), Positives = 19/37 (51%)
 Frame = +1

Query: 133 NLEQEYEMQKTWHDDEDKCTFIILDKDIFNNTAFDEI 243
           N E  ++  +  +++     F  +D +IFN   FD+I
Sbjct: 213 NSELLFKELQAAYEETFSLVFTKIDNEIFNRVPFDKI 249


>DQ494417-1|ABF55368.1|   42|Apis mellifera telomerase reverse
           transcriptase protein.
          Length = 42

 Score = 21.8 bits (44), Expect = 4.4
 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%)
 Frame = -3

Query: 243 YFIEGCIIKYILVQNDKC-AFI 181
           YF + C+   IL++ +KC AFI
Sbjct: 17  YFQQYCLHHKILIKKNKCNAFI 38


>DQ013068-1|AAY81956.1|  931|Apis mellifera dusty protein kinase
           isoform B protein.
          Length = 931

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -3

Query: 246 IYFIEGCIIKYIL 208
           +YFI GC+  Y++
Sbjct: 283 LYFIRGCLQTYLI 295


>DQ013067-1|AAY81955.1|  969|Apis mellifera dusty protein kinase
           isoform A protein.
          Length = 969

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -3

Query: 246 IYFIEGCIIKYIL 208
           +YFI GC+  Y++
Sbjct: 321 LYFIRGCLQTYLI 333


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 127,546
Number of Sequences: 438
Number of extensions: 2375
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -