BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314E10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 5.8 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 7.7 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.7 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 430 TLNVYPVTSRVTQHCHHITQR 368 T ++YP S H HH Q+ Sbjct: 85 TSSMYPYVSAAAAHHHHQQQQ 105 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/42 (23%), Positives = 17/42 (40%) Frame = -2 Query: 424 NVYPVTSRVTQHCHHITQRHERPCIASKYSFNITTINKQSQK 299 N + V + C + RH + + + FN+T K K Sbjct: 205 NAFEYAMAVMKMCDILHLRHTKIWLRPDWLFNLTKYGKNQIK 246 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/22 (31%), Positives = 11/22 (50%) Frame = -2 Query: 187 NYTLNGCSYRYLFGRVKKLIIY 122 NY N +Y+Y + K + Y Sbjct: 321 NYNYNNNNYKYNYNNYNKKLYY 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,608 Number of Sequences: 438 Number of extensions: 2894 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -