BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314E10f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07970.1 68416.m00974 polygalacturonase, putative / pectinase... 28 3.3 >At3g07970.1 68416.m00974 polygalacturonase, putative / pectinase, putative similar to polygalacturonase precursor [Cucumis melo] GI:3320462; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases); contains non-consensus AA donor splice site at exon 2 Length = 439 Score = 28.3 bits (60), Expect = 3.3 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = -2 Query: 424 NVYPVTSRVTQHCH-----HITQRHERPCIASKYSFNITTINKQSQKN 296 NVY T+R QH H H+ RH +S SFN+ T ++ N Sbjct: 36 NVYYETNRQHQHGHNTRNSHLKNRHGYAPRSSPRSFNVNTFGAKANGN 83 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,013,650 Number of Sequences: 28952 Number of extensions: 153655 Number of successful extensions: 246 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -