BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314E09f (413 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 23 1.8 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 23 1.8 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.3 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 20 9.6 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 20 9.6 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 22.6 bits (46), Expect = 1.8 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 26 PKLYQEYTTKTPKKLKIIDAYLFYIFLTAVIQFGYCCLVGTF 151 P L +EY KLKII+ F L + + CL+ F Sbjct: 35 PLLKKEYPLVMDTKLKIIEILQF--ILDVRLDYRISCLLSIF 74 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 22.6 bits (46), Expect = 1.8 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 26 PKLYQEYTTKTPKKLKIIDAYLFYIFLTAVIQFGYCCLVGTF 151 P L +EY KLKII+ F L + + CL+ F Sbjct: 3 PLLKKEYPLVMDTKLKIIEILQF--ILDVRLDYRISCLLSIF 42 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.6 bits (41), Expect = 7.3 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 58 SFRCVFLIQFW 26 +FRCVF++ W Sbjct: 48 TFRCVFVLDPW 58 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 20.2 bits (40), Expect = 9.6 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +1 Query: 241 QE*VPRVECRTWLCRFHICTSGVAYCCYQFHRIKYK 348 +E +PRVE C+ + ++ +QF + Y+ Sbjct: 102 EEYIPRVESVVETCKKEVTSTEGCEVAWQFGKCIYE 137 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 20.2 bits (40), Expect = 9.6 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +1 Query: 241 QE*VPRVECRTWLCRFHICTSGVAYCCYQFHRIKYK 348 +E +PRVE C+ + ++ +QF + Y+ Sbjct: 76 EEYIPRVESVVETCKKEVTSTEGCEVAWQFGKCIYE 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,317 Number of Sequences: 438 Number of extensions: 2119 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10503195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -