BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314E03f (489 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 6.0 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 6.0 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 6.0 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 6.0 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -3 Query: 367 IGENVMVGWFSRPFTTYTTASYVNV 293 +G + S TTYTT+ ++NV Sbjct: 673 VGNYTCLASNSASVTTYTTSLFINV 697 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 165 SRIFDEILKRNYIXXXXXLPQDGWCIYVVDVYGLS 61 S IF + ++ PQ+ WCI +Y LS Sbjct: 1004 SAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLS 1038 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 165 SRIFDEILKRNYIXXXXXLPQDGWCIYVVDVYGLS 61 S IF + ++ PQ+ WCI +Y LS Sbjct: 1004 SAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLS 1038 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 165 SRIFDEILKRNYIXXXXXLPQDGWCIYVVDVYGLS 61 S IF + ++ PQ+ WCI +Y LS Sbjct: 1004 SAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLS 1038 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 165 SRIFDEILKRNYIXXXXXLPQDGWCIYVVDVYGLS 61 S IF + ++ PQ+ WCI +Y LS Sbjct: 1004 SAIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLS 1038 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,395 Number of Sequences: 336 Number of extensions: 1803 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -