BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314E03f (489 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) 30 1.2 SB_29770| Best HMM Match : ig (HMM E-Value=3.4e-05) 28 3.6 SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) 28 4.7 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 27 8.3 >SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) Length = 708 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 21 VDELTAHL--VLSGYWRAHRHLQRKCTTHLEV 110 +++LTA V++G+WR ++HL K HL V Sbjct: 438 LNQLTAQANDVMAGFWRRNKHLTEKLCQHLVV 469 >SB_29770| Best HMM Match : ig (HMM E-Value=3.4e-05) Length = 454 Score = 28.3 bits (60), Expect = 3.6 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -1 Query: 462 PPLEDTYARSSSN*TLVMPSVXLSFVSYXA 373 P L D YAR S T V V +SF SY A Sbjct: 219 PHLVDAYARESIQFTRVSGGVNISFTSYRA 248 >SB_4760| Best HMM Match : EGF (HMM E-Value=8.29989e-42) Length = 240 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 343 WFSRPFTTYTTASYVNVLKLFKYFPS 266 W R F Y A VN F YFPS Sbjct: 6 WLCRVFLVYGAALVVNADSYFSYFPS 31 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 418 ACDAVCXVKFCKLXRLGIGENVMVGWFSRPF 326 A D VC V KL LG+ E+ + WFS F Sbjct: 1455 AFDTVCHVLLQKLPGLGVAEDEL-RWFSNSF 1484 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,725,326 Number of Sequences: 59808 Number of extensions: 220256 Number of successful extensions: 489 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1038380485 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -