BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314E01f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 29 2.3 SB_25986| Best HMM Match : Myosin_head (HMM E-Value=1.4e-17) 28 4.1 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 442 KTKNPHFDLNLISSSTANRRIYKFFF 519 K KNPHFDL ++S+ + I+ +F Sbjct: 369 KLKNPHFDLKFVTSTVSMNDIFWEYF 394 >SB_25986| Best HMM Match : Myosin_head (HMM E-Value=1.4e-17) Length = 1189 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -1 Query: 359 GIMYNCILTYITNKCEMYYESIIVENYPVCR*FRCYSTVITVCRY 225 GI+ N ++ Y NK Y S++V P C F Y T + RY Sbjct: 846 GILRNLLIRYRANKIYTYVGSVLVAVNPYCS-FPIYGTAY-ISRY 888 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,547,811 Number of Sequences: 59808 Number of extensions: 233337 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -