BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314D10f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.06c |||threonine synthase |Schizosaccharomyces pombe|chr... 25 5.2 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 25 6.8 SPAC4G9.07 |mug133||S. pombe specific UPF0300 family protein 2|S... 25 6.8 >SPAC9E9.06c |||threonine synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 514 Score = 25.4 bits (53), Expect = 5.2 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -3 Query: 345 CLKTTDESTVTQFCLNK*NLSRFNRVANWNLIVY 244 CL+ T + +T CL+ + ++F++ N L Y Sbjct: 433 CLEKTKDQDITYICLSTAHPAKFDKAVNLALSSY 466 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 209 LTKSGQISINGSYTIKFQFATRLKRLRFYLFRQNWVTVLSS 331 + + ++ IN + F+ + Y+ QNWVT LSS Sbjct: 751 INSATEMPINEPLSASFESVNKENSQSGYMAWQNWVTELSS 791 >SPAC4G9.07 |mug133||S. pombe specific UPF0300 family protein 2|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 493 CRGISRRCTAEPSRYNSWPCEPILLATI 410 C+ S T + + Y P EP+LLA I Sbjct: 484 CKPASNLLTLKDNSYTQIPLEPLLLAEI 511 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,791,457 Number of Sequences: 5004 Number of extensions: 34808 Number of successful extensions: 58 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -