BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314D03f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 2.9 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 6.6 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 21 6.6 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 11 RGKNSKSTDW 40 RGKN+K DW Sbjct: 460 RGKNAKDVDW 469 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 Query: 520 YTHTHAHTHVYP 485 YTH +A H YP Sbjct: 169 YTHHYARYHPYP 180 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.0 bits (42), Expect = 6.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 233 GRHAVGGDRPRSGQGGDDDDVLVRAVPTGAALVGR 129 G A+GG+ G+ DD V R P AA R Sbjct: 513 GDGALGGEVCMWGEYVDDSSVESRVWPRAAAAAER 547 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,809 Number of Sequences: 336 Number of extensions: 1799 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -