BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314D03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 5.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 5.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 5.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 5.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.7 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 5.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -2 Query: 262 IILKTFSPMVVGMLWEVTDLEVDKVVTTMMSLYVPS---RQALP 140 IIL T S + + W V VTTM++ + S R LP Sbjct: 312 IILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLP 355 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 5.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -2 Query: 262 IILKTFSPMVVGMLWEVTDLEVDKVVTTMMSLYVPS---RQALP 140 IIL T S + + W V VTTM++ + S R LP Sbjct: 281 IILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLP 324 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 5.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -2 Query: 262 IILKTFSPMVVGMLWEVTDLEVDKVVTTMMSLYVPS---RQALP 140 IIL T S + + W V VTTM++ + S R LP Sbjct: 332 IILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLP 375 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 5.8 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = -2 Query: 262 IILKTFSPMVVGMLWEVTDLEVDKVVTTMMSLYVPS---RQALP 140 IIL T S + + W V VTTM++ + S R LP Sbjct: 281 IILVTSSFITFWLEWNAVPARVMIGVTTMLNFFTTSNGFRSTLP 324 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 197 GQGGDDDDVLVRAVPTGAALVGR 129 G G D DDV+ + G A + + Sbjct: 1612 GHGSDKDDVVYQQTGVGGATLDK 1634 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,963 Number of Sequences: 438 Number of extensions: 1736 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -