BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C11f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0341 + 14778915-14778961,14778982-14779860,14780101-14782804 28 4.0 08_02_1381 - 26551920-26552053,26552963-26553070,26553154-265533... 27 6.9 06_01_0698 + 5093656-5093899,5094736-5094908 27 6.9 10_08_0993 + 22087050-22087118,22087361-22087430,22087922-220879... 27 9.1 10_07_0098 - 12844631-12845074,12845329-12846570 27 9.1 >06_02_0341 + 14778915-14778961,14778982-14779860,14780101-14782804 Length = 1209 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 298 PGNNPGRCPRSLASRAGRRTPCSSSCCFVSDCLRHL**AHPCYRCRLVC 152 P NP + PRS + T S + D + HL PC++C ++C Sbjct: 1132 PPANP-KSPRSKDVASDEMTDPSPNVSVKYDVISHLKKYQPCFQCMMLC 1179 >08_02_1381 - 26551920-26552053,26552963-26553070,26553154-26553340, 26554107-26554316 Length = 212 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +1 Query: 286 DCFPVEFTLILAENYVKLMYRRDGLAFTLSDNGGVAYGDSKDRTSSR 426 D V F +I A+ Y DG+ + D G DS+D+TS + Sbjct: 45 DTVHVSFVVIKADT--PWHYSEDGVDLVVKDPNGAQVRDSRDKTSDK 89 >06_01_0698 + 5093656-5093899,5094736-5094908 Length = 138 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -2 Query: 295 GNNPGRCPRSLASRAGRRTPCSSSCCFVSD 206 G++P + +R+G R+PC++ C V D Sbjct: 12 GDDPATAATAPPTRSGHRSPCAARCGKVGD 41 >10_08_0993 + 22087050-22087118,22087361-22087430,22087922-22087999, 22088180-22088251,22090258-22090311,22090651-22090817 Length = 169 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -2 Query: 271 RSLASRAGRRTP---CSSSCCFVSD 206 RSL++RAG RTP CS C D Sbjct: 103 RSLSARAGNRTPGSRCSKVACLARD 127 >10_07_0098 - 12844631-12845074,12845329-12846570 Length = 561 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/38 (28%), Positives = 24/38 (63%), Gaps = 4/38 (10%) Frame = +1 Query: 157 LIYTDNKGELITNVVNN----LIRNNKMNCMEYAYQLW 258 ++YT+N+G ++T V + + NK+NC+ + ++ W Sbjct: 275 MVYTENEGVMMTGVYASKEEAKKKGNKINCVGWWFKPW 312 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,454,271 Number of Sequences: 37544 Number of extensions: 234813 Number of successful extensions: 700 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -