BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 27 0.50 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 27 0.50 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 1.2 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 26.6 bits (56), Expect = 0.50 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 217 SPHIIQCLNFIALRKFSSIAMLTIFLYSLLRRIKANISINRNLA 348 S HI+ + + L FS+ LT+ R+++A+ IN LA Sbjct: 45 SGHILSIMVYTTLMVFSATGNLTVLSILAQRKVRASSRINIMLA 88 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 26.6 bits (56), Expect = 0.50 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 217 SPHIIQCLNFIALRKFSSIAMLTIFLYSLLRRIKANISINRNLA 348 S HI+ + + L FS+ LT+ R+++A+ IN LA Sbjct: 45 SGHILSIMVYTTLMVFSATGNLTVLSILAQRKVRASSRINIMLA 88 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.4 bits (53), Expect = 1.2 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = +2 Query: 167 TVFIYFMNTRCYYYNTYLLISSSA*TLLRFVSFRLLPC 280 TV+ Y++ T+C +TYL + A LR V+ LLPC Sbjct: 20 TVYYYYLFTQCNPLSTYLYRTILA---LRLVT--LLPC 52 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 454,888 Number of Sequences: 2352 Number of extensions: 8006 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -