BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C04f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23179-4|AAK68209.1| 341|Caenorhabditis elegans Serpentine rece... 29 2.7 AL132858-1|CAB60474.1| 325|Caenorhabditis elegans Hypothetical ... 27 8.1 >U23179-4|AAK68209.1| 341|Caenorhabditis elegans Serpentine receptor, class b (beta)protein 3 protein. Length = 341 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 123 FLYYYLGLN*SI*IYCFARLLVLRARCFIFFYFRFKIP 10 FL+++ L + +Y LL A CF FFY +F IP Sbjct: 49 FLHFHGNLKCLLIVYFICNLLFSMALCFAFFY-QFLIP 85 >AL132858-1|CAB60474.1| 325|Caenorhabditis elegans Hypothetical protein Y113G7A.1 protein. Length = 325 Score = 27.1 bits (57), Expect = 8.1 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -1 Query: 377 SQKTRIFHYIHVTACYYIFSVNTISSIEFVKAIIYIIILKFSSSFIGN 234 S+KT ++ + A SVNT I V A+IYI+ + + + N Sbjct: 224 SKKTIQMQHLLIFALILQASVNTFLFIVPVNAVIYIVYIHHQNQLLNN 271 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,754,628 Number of Sequences: 27780 Number of extensions: 179069 Number of successful extensions: 368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -