BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C04f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 23 1.9 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 7.7 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 23.0 bits (47), Expect = 1.9 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 216 NSSWQAISNERRTKF*NDNINYCLNELDRTDRIYAKYVVT 335 N SW + R+T+ + N NEL RT + +VT Sbjct: 64 NFSWGSECTTRKTRIIDVVYNASNNELVRTKTLVKNAIVT 103 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 165 SIKVNYKTRTYDYN 206 S+ ++YK R YD N Sbjct: 55 SLDIDYKQRVYDKN 68 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,347 Number of Sequences: 438 Number of extensions: 2479 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -