BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18G6.10 |||chromosome segregation protein |Schizosaccharomyc... 37 0.002 SPAC18B11.02c |||pseudouridylate synthase |Schizosaccharomyces p... 28 0.73 >SPAC18G6.10 |||chromosome segregation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 688 Score = 37.1 bits (82), Expect = 0.002 Identities = 16/44 (36%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = -1 Query: 395 SSIQNLIRDDKLWFTRIMQQIHRHACLWSGIR--FYDIRFSNYR 270 S + + DD+L+ ++QQ + + LWS I+ F+DI+++NYR Sbjct: 257 SEVDSAEEDDELFQNYVLQQTRKESKLWSFIKKVFHDIKYANYR 300 >SPAC18B11.02c |||pseudouridylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 394 Score = 28.3 bits (60), Expect = 0.73 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 232 CSLLESCNKLDTIVSGL 182 CSLL CN+LD + SGL Sbjct: 146 CSLLYPCNRLDRLTSGL 162 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,953,879 Number of Sequences: 5004 Number of extensions: 36753 Number of successful extensions: 99 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -