BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C02f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12486| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=2.9) 27 7.1 SB_51009| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-14) 27 9.4 >SB_12486| Best HMM Match : 7TMR-DISM_7TM (HMM E-Value=2.9) Length = 492 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 11/42 (26%) Frame = -1 Query: 146 FNFFFIVAYKIWQRCM------VNGYDYPLFF-----CFSIF 54 F +F+ V + ++ RC V YDYP+FF CFS++ Sbjct: 199 FRYFYPVFFAMFTRCFSLCFPGVYRYDYPVFFAIFTRCFSLY 240 >SB_51009| Best HMM Match : 7tm_1 (HMM E-Value=2.8e-14) Length = 579 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 104 CMVNGYDYPLFFCFSIFYIVFMILNNKY 21 C NG+ LFFC SIF + + L +KY Sbjct: 354 CHANGFLNNLFFCASIFTLALIAL-HKY 380 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,680,092 Number of Sequences: 59808 Number of extensions: 158079 Number of successful extensions: 319 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 319 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -