BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314C01f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 5.8 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 21 5.8 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 5.8 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = +2 Query: 95 LCARPFRSLNEQFRE*QI*KVSCNMNKEY*LGLF*DVVYIYEIEIAGMSW 244 L P+R+L RE + + + N + G F VY+ + I +SW Sbjct: 214 LMGSPYRNLTFVRREGEFSVLQVSFNLQRHTGYFLIQVYVPCVLIVVLSW 263 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 132 FANNKSKRYHAI*IRSIN 185 F+NNKSK+Y + +N Sbjct: 40 FSNNKSKKYFEQTLNELN 57 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,222 Number of Sequences: 438 Number of extensions: 2440 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -