BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 27 0.38 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 26 0.67 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 25 1.2 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 3.6 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 23 4.7 AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranfe... 23 4.7 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 8.2 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 27.1 bits (57), Expect = 0.38 Identities = 21/78 (26%), Positives = 34/78 (43%) Frame = +2 Query: 266 KSVCGFRRRVLVGYLCDEFPWLGDVLGARASRPHEEDADERRSRRITVRSDIDTADVLPR 445 K CG ++ +LCDEFP L R++ + +D + V +T +L + Sbjct: 31 KRYCGAELVKVLSFLCDEFPDL-HTTSKRSADNFAKPSDMATEDWMNVED--NTQQILDQ 87 Query: 446 ACRRVRAPPTNTAT*PEW 499 + V P + AT P W Sbjct: 88 QLQSV-GMPDDRATVPAW 104 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 26.2 bits (55), Expect = 0.67 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +2 Query: 305 YLCDEFPWLGDVLGARASRPHEEDADERRSRRITVRSDIDTADVLPR 445 YL D + +G L R S +AD R + R T DI A+ LPR Sbjct: 35 YLTDRYKPIGQSLQTRFS----SEADTRIAVRATTLPDIRFAEELPR 77 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 25.4 bits (53), Expect = 1.2 Identities = 19/78 (24%), Positives = 34/78 (43%) Frame = +2 Query: 266 KSVCGFRRRVLVGYLCDEFPWLGDVLGARASRPHEEDADERRSRRITVRSDIDTADVLPR 445 K CG ++ +LCDEFP L R++ + +D + + ++ +T +L + Sbjct: 31 KRYCGAELVKVLSFLCDEFPDL-HTTSKRSADNFAKPSD--MATEDWMNAEDNTQQILDQ 87 Query: 446 ACRRVRAPPTNTAT*PEW 499 + V P A P W Sbjct: 88 QLQSVGMPDDRAAV-PAW 104 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 406 GDPARSPLICVFFMRTG 356 GD RSPL C ++R G Sbjct: 443 GDQVRSPLACFEWLRAG 459 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 374 LLHEDGKPVLQGHLQARGTH 315 L+HED KPV+ L R H Sbjct: 143 LIHEDDKPVIARALLLRHRH 162 >AY255857-1|AAP13483.1| 216|Anopheles gambiae glutathione tranferase d9 protein. Length = 216 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 337 ISKPGELIT*IPNQHTPPKTTYTFSPGP 254 I +PG ++ + Q+ P TTY + P P Sbjct: 62 ICEPGAILIYLAEQYAPAGTTY-YPPDP 88 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 86 PPFDKRNPF 112 PPFD +NPF Sbjct: 277 PPFDAKNPF 285 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 588,255 Number of Sequences: 2352 Number of extensions: 12793 Number of successful extensions: 25 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -