BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B12f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53333-9|AAA96162.1| 117|Caenorhabditis elegans Hypothetical pr... 29 1.5 AL117202-9|CAB57892.1| 352|Caenorhabditis elegans Hypothetical ... 28 4.7 U23527-1|AAC46575.2| 1147|Caenorhabditis elegans Neuronal igcam ... 27 6.2 Z81033-1|CAB02724.1| 199|Caenorhabditis elegans Hypothetical pr... 27 8.1 >U53333-9|AAA96162.1| 117|Caenorhabditis elegans Hypothetical protein F36A4.3 protein. Length = 117 Score = 29.5 bits (63), Expect = 1.5 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 472 RWRANATARPRQDIG-SIDVRPHGDPAR 392 +W R Q +G ID RPHG P+R Sbjct: 83 KWSKKVNGRVGQSVGFDIDARPHGKPSR 110 >AL117202-9|CAB57892.1| 352|Caenorhabditis elegans Hypothetical protein Y47D3A.12 protein. Length = 352 Score = 27.9 bits (59), Expect = 4.7 Identities = 11/27 (40%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = +2 Query: 62 LSPTFLFPP-PFDKRNPFFFNKH*FNT 139 L+P + PP + ++NP+FFN++ F+T Sbjct: 262 LTPPAISPPMDYTQQNPYFFNQNFFST 288 >U23527-1|AAC46575.2| 1147|Caenorhabditis elegans Neuronal igcam protein 1, isoform a protein. Length = 1147 Score = 27.5 bits (58), Expect = 6.2 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 236 LSGTRSGARTKSVCGFRRRVLVGYLCDEFPWLGDVLGARASRPHEE 373 LS S AR +SV + R ++ ++ W G +L +RP E Sbjct: 54 LSAGYSEARMQSVVWLKDREIISINDTDYTWKGFILTIHGTRPQNE 99 >Z81033-1|CAB02724.1| 199|Caenorhabditis elegans Hypothetical protein C03C11.1 protein. Length = 199 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 153 SLGANVLNQCLLKKKGFLLSNGGGNKKVG 67 +L V+ QC KKK SNGGG K G Sbjct: 23 ALAGYVIAQCGGKKKAGGSSNGGGGAKTG 51 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,772,444 Number of Sequences: 27780 Number of extensions: 280392 Number of successful extensions: 682 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 682 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -