BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B10f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56680| Best HMM Match : PTR2 (HMM E-Value=3e-06) 31 0.44 SB_8945| Best HMM Match : ABC-3 (HMM E-Value=0.26) 31 0.44 SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) 31 0.44 SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 31 0.76 SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 31 0.76 SB_6707| Best HMM Match : Mucin (HMM E-Value=9.3) 30 1.3 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 28 5.4 SB_20837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_21631| Best HMM Match : SRP19 (HMM E-Value=7.9) 27 7.1 SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) 27 7.1 SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27) 27 7.1 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_36806| Best HMM Match : RVT_1 (HMM E-Value=3.1e-35) 27 9.4 SB_2394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_20303| Best HMM Match : Trans_reg_C (HMM E-Value=0.38) 27 9.4 SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_56680| Best HMM Match : PTR2 (HMM E-Value=3e-06) Length = 606 Score = 31.5 bits (68), Expect = 0.44 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 7/81 (8%) Frame = +3 Query: 240 SRNGFSNSIISRQIITTTK-------MHRYNILGRFSLSSTIKSNSIIMRFCSSTPKPKT 398 + NGF+N S ++ K M +Y +LG + +++ I+ C STP+ T Sbjct: 436 TENGFTNQTTSCKVYHVVKGFNILWQMPQYALLGMSEVFASMTGLEIVYSLCPSTPQSVT 495 Query: 399 SRAVGYWLLGCSGMVFTAVVL 461 S Y ++ C G + + V + Sbjct: 496 SAI--YNIMICIGSILSFVTM 514 >SB_8945| Best HMM Match : ABC-3 (HMM E-Value=0.26) Length = 555 Score = 31.5 bits (68), Expect = 0.44 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +3 Query: 378 STPKPKTSRAVGYWLLGCSGMVFTAVVLGGVTRLTESGLSMVTW 509 S P+ ++ GYW L C + A V+ VT E+G + V++ Sbjct: 267 SKPERAAPQSPGYWALFCETWLTPAYVIAAVTLTLETGTAFVSY 310 >SB_25762| Best HMM Match : VWD (HMM E-Value=2.2e-16) Length = 705 Score = 31.5 bits (68), Expect = 0.44 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 487 DSVSRVTPPSTTAVKTIPLHPSSQYPTALDVFGLGVEEQ 371 ++ S P+T+AV T P++ P LD GLGVE++ Sbjct: 384 EAPSTTEVPTTSAVPTTTGAPTTAPPDCLDALGLGVEDR 422 >SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 317 Score = 30.7 bits (66), Expect = 0.76 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +2 Query: 260 QYYFKANYHNYKNAQI*HPRKVQSKQHNKIKQYYNAILLFNS*TEDVKSSWILATRMQWY 439 QY FK +H+ A I K+ S NK ++ + + S DV + IL T++Q+Y Sbjct: 212 QYGFK-KHHSTALALIHLYDKLSSAIDNK--EFTMGVFIDLSKAFDVVNHEILLTKLQYY 268 Query: 440 GLHCCSTRW--RHPTDRVRFV 496 G+ S +W + ++R++FV Sbjct: 269 GVRETSLKWFESYLSERMQFV 289 >SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 243 Score = 30.7 bits (66), Expect = 0.76 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 2/81 (2%) Frame = +2 Query: 260 QYYFKANYHNYKNAQI*HPRKVQSKQHNKIKQYYNAILLFNS*TEDVKSSWILATRMQWY 439 QY FK +H+ A I K+ S NK ++ + + S DV + IL T++Q+Y Sbjct: 138 QYGFK-KHHSTALALIHLYDKLSSAIDNK--EFTMGVFIDLSKAFDVVNHEILLTKLQYY 194 Query: 440 GLHCCSTRW--RHPTDRVRFV 496 G+ S +W + ++R++FV Sbjct: 195 GVRETSLKWFDSYLSERMQFV 215 >SB_6707| Best HMM Match : Mucin (HMM E-Value=9.3) Length = 186 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 378 STPKPKTSRAVGYWLLGCSGMVFTAVVLGGVTRLTESGLSMVTW 509 S P+ ++ GYW L C A V+ VT E+G + V++ Sbjct: 140 SKPERAAPQSPGYWALFCETWRTPAYVIAAVTLTLETGTAFVSY 183 >SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 1198 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 267 ISRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 I+++ I H +N LG+ S TI+ FC +TP+ Sbjct: 231 INKETIVRKNPHLFNGLGKLSGEYTIRLKEGAKSFCLTTPR 271 >SB_20837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1304 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/74 (25%), Positives = 32/74 (43%) Frame = +3 Query: 282 ITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPKPKTSRAVGYWLLGCSGMVFTAVVL 461 +TT KM ++ L S +K S+I K R++ W LGC + + +L Sbjct: 684 VTTEKMALFSGEVDHPLVSQLKDPSVIKSGAGDGRYSKGKRSLLTWALGCGALKLNSDLL 743 Query: 462 GGVTRLTESGLSMV 503 T + +SM+ Sbjct: 744 DLETSSKDGTISML 757 >SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1571 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 267 ISRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 I+++ I H +N LG+ S TI+ FC +TP+ Sbjct: 402 INKETIVRKNPHLFNGLGKLSGEYTIRLKEEAKPFCLTTPR 442 >SB_21631| Best HMM Match : SRP19 (HMM E-Value=7.9) Length = 201 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 267 ISRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 I+++ I H +N LG+ S TI+ FC +TP+ Sbjct: 49 INKETIVRKNPHPFNGLGKLSGEYTIRLKEGAKPFCLTTPR 89 >SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) Length = 1191 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 267 ISRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 I+++ I H +N LG+ S TI+ FC +TP+ Sbjct: 398 INKETIVRKNPHPFNGLGKLSGEYTIRLKEGAKPFCLTTPR 438 >SB_11123| Best HMM Match : RVT_1 (HMM E-Value=3.4e-27) Length = 1154 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/41 (34%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = +1 Query: 190 VDVSSL*VQCKVNSWCHLEMASVTVL---FQGKLSQLQKCT 303 ++++S + +V++ C + + S L ++GKL QLQKCT Sbjct: 128 IEINSRPLCFEVDTGCPVTLISEETLNSVYEGKLPQLQKCT 168 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 267 ISRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 I+++ I H +N LG+ S TI+ FC +TP+ Sbjct: 395 INKETIVRKNPHLFNGLGKLSGEYTIRLKEGAKPFCLTTPR 435 >SB_36806| Best HMM Match : RVT_1 (HMM E-Value=3.1e-35) Length = 380 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 270 SRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 +R+ I H +N LG+ S TI+ FC +TP+ Sbjct: 62 NRETIVRKNPHLFNGLGKLSGEYTIRLKEGAKPFCLTTPR 101 >SB_2394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 590 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 181 HDFVDVSSL*VQCKVNSWCHL 243 HDF SS+ V VN WC++ Sbjct: 361 HDFFQPSSMGVSYTVNQWCNI 381 >SB_20303| Best HMM Match : Trans_reg_C (HMM E-Value=0.38) Length = 1354 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/47 (29%), Positives = 23/47 (48%) Frame = +1 Query: 136 YSSVYLTVVQLC*TSHDFVDVSSL*VQCKVNSWCHLEMASVTVLFQG 276 Y SV +++ +L +HD + SS V V WC + T+ +G Sbjct: 1303 YLSVPVSLTELLHWNHDTLSFSSSVVALAVERWCSDDRVKQTIAAKG 1349 >SB_19905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 267 ISRQIITTTKMHRYNILGRFSLSSTIKSNSIIMRFCSSTPK 389 I+++ I H +N LG+ S TI+ FC +TP+ Sbjct: 395 INKETIVRKNPHIFNGLGKLSGEYTIRLKEGAKPFCLTTPR 435 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,924,275 Number of Sequences: 59808 Number of extensions: 273247 Number of successful extensions: 854 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -