BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 26 0.27 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 0.62 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 0.82 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 3.3 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.4 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 5.8 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 5.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 5.8 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 25.8 bits (54), Expect = 0.27 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 375 SSTPKPKTSRAVGYWLLGCSGMVFTAVV 458 +S PK +A W LGC+ +F A+V Sbjct: 283 NSLPKVSYIKASEIWFLGCTIFLFAAMV 310 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.6 bits (51), Expect = 0.62 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = +3 Query: 420 LLGCSGMVFTAVVLGGVTRLTESGLSM 500 L+ CSG+VF +++ GV + + +M Sbjct: 769 LIICSGLVFVQILINGVWMIIDPAKAM 795 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 24.2 bits (50), Expect = 0.82 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 375 SSTPKPKTSRAVGYWLLGC 431 S+ P+P + A+G+W + C Sbjct: 371 SAIPEPSKNPAMGHWQMSC 389 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 427 PSSQYPTALDVF 392 P YPTALD F Sbjct: 268 PKVPYPTALDFF 279 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 375 SSTPKPKTSRAVGYWLLGCSGMVFTAV 455 S P +A+ W+ GC VF A+ Sbjct: 251 SDIPPVAYVKALDVWMAGCMMFVFAAL 277 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 113 IYQHA*DSIHQYT*QLYSY 169 +YQ+A DS H+ T + Y Sbjct: 213 VYQNADDSFHRLTSNTFDY 231 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 4.4 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 405 AVGYWLLGCSGMVFTAVVLGGVTRLTESG 491 AV + C G+ FTA G TE G Sbjct: 277 AVSGMVFDCGGLEFTAAPFNGWYMSTEIG 305 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 Query: 113 IYQHA*DSIHQYT*QLYSYAEPLTTLSM 196 +YQ++ DS H+ T + Y T L++ Sbjct: 218 MYQNSDDSFHRLTSNTFDYDPRYTKLTV 245 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 378 STPKPKTSRAVGYWLLGCSGMVFTAVV 458 S P +A+ W+ CS VF +++ Sbjct: 266 SLPPVSYVKAIDVWMSSCSVFVFLSLM 292 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 5.8 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +3 Query: 306 YNILGRFSLSSTIKSNSIIMRFCSSTPKPKTSRAVGYWLLGC 431 Y ++G SS ++ S++P+P +S A L GC Sbjct: 816 YLMVGNSPASSPRYLSAAATSSTSTSPRPASSTAATLVLSGC 857 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,966 Number of Sequences: 438 Number of extensions: 2526 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -