BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2G2.10c |mug110||sequence orphan|Schizosaccharomyces pombe|c... 27 1.3 SPAC9E9.09c |||aldehyde dehydrogenase|Schizosaccharomyces pombe|... 27 1.3 SPAC644.14c |rhp51|rad51|recombinase Rhp51|Schizosaccharomyces p... 26 3.9 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 25 6.8 SPAC1B1.04c |||poly|Schizosaccharomyces pombe|chr 1|||Manual 25 9.0 >SPBC2G2.10c |mug110||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 248 Score = 27.5 bits (58), Expect = 1.3 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -1 Query: 464 PDPSLYGRGPSTKNASDHTFLF 399 P+P+L P+T+ AS++T+L+ Sbjct: 174 PEPALLPEAPNTREASNNTYLY 195 >SPAC9E9.09c |||aldehyde dehydrogenase|Schizosaccharomyces pombe|chr 1|||Manual Length = 503 Score = 27.5 bits (58), Expect = 1.3 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = +2 Query: 374 HREGGV*FQIGTYGRKHFLLTDLVHKDLGL 463 ++E G+ ++G+YG ++ T VH +LG+ Sbjct: 470 YKESGIGRELGSYGLTNYTQTKAVHINLGM 499 >SPAC644.14c |rhp51|rad51|recombinase Rhp51|Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 25.8 bits (54), Expect = 3.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 461 LVFDSITAIVGTGFNGRGD 517 LV DS TA+ T F+GRG+ Sbjct: 241 LVVDSCTALYRTDFSGRGE 259 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 25.0 bits (52), Expect = 6.8 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 4/40 (10%) Frame = -1 Query: 452 LYGRGPST----KNASDHTFLFETIHHPPDGETSCIHVCC 345 LY +G T + ASD+ +L TIHH D T + C Sbjct: 674 LYVKGADTVIMERLASDNPYLQTTIHHLEDYATVGLRTLC 713 >SPAC1B1.04c |||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 454 VFMDEVRQQKMLPTIRSYL 398 +F +E+R Q +LPT+ SY+ Sbjct: 449 IFNEELRIQTLLPTMLSYM 467 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,063,751 Number of Sequences: 5004 Number of extensions: 40087 Number of successful extensions: 82 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -