BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B02f (436 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.08c |qcr6||ubiquinol-cytochrome-c reductase complex sub... 40 1e-04 SPAC11E3.11c |||guanyl-nucleotide exchange factor |Schizosacchar... 27 1.6 SPBC428.01c |nup107|SPBC582.11c|nucleoporin Nup107|Schizosacchar... 25 3.8 SPBC19C2.10 |||BAR adaptor protein|Schizosaccharomyces pombe|chr... 25 5.0 SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 25 6.7 SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 25 6.7 >SPBC16C6.08c |qcr6||ubiquinol-cytochrome-c reductase complex subunit 8|Schizosaccharomyces pombe|chr 2|||Manual Length = 214 Score = 40.3 bits (90), Expect = 1e-04 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = +1 Query: 112 LVDPQQSLREECSQKPDAQNMWAKYQECNDRVNSR---SKTAETCEEELIDYVHVLDKCV 282 + DP + + +EC PD + + ++EC RV + +E C EE H C Sbjct: 146 ITDPLEKMTQECMDAPDCKEVKHHFEECTARVTKKVEQGDKSEDCIEEFFHLYHCARDCA 205 Query: 283 TKDLFKRL 306 +FK L Sbjct: 206 DPKVFKVL 213 >SPAC11E3.11c |||guanyl-nucleotide exchange factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 942 Score = 26.6 bits (56), Expect = 1.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 300 LKQVLGDAFVKNMDIVNEFFFTGFCSFRS 214 +KQ L D+F N + N FF + + SF S Sbjct: 468 IKQALNDSFDGNEEKKNAFFLSSYKSFAS 496 >SPBC428.01c |nup107|SPBC582.11c|nucleoporin Nup107|Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 25.4 bits (53), Expect = 3.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 249 EFFFTGFCSFRSGVY 205 +FF T FC FRSG + Sbjct: 231 QFFHTAFCLFRSGSF 245 >SPBC19C2.10 |||BAR adaptor protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 25.0 bits (52), Expect = 5.0 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +1 Query: 124 QQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDYV 261 Q++ +EE + D +N AKY+E + R + E + ++ V Sbjct: 158 QKAKKEESKLEEDLRNARAKYEESLEEFEDRMVQLKELEPDRVENV 203 >SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 862 Score = 24.6 bits (51), Expect = 6.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 279 AFVKNMDIVNEFFFTGFCSFRSGVYTII 196 A +KN D VN ++ SGV TI+ Sbjct: 51 AVIKNFDEVNRMYYIQVVGNLSGVITIV 78 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 24.6 bits (51), Expect = 6.7 Identities = 14/56 (25%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 112 LVDPQQSLREE-CSQKPDAQNMWAKYQECNDRVNSRSKTAETCEEELIDYVHVLDK 276 L + +SL+E+ S+K + QN+ ++ CN ++ + + + E + V DK Sbjct: 742 LDESYKSLQEQLASKKIEVQNVSSQLSICNSQLEQSNHIVDNLKSENLLLTSVKDK 797 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,574,664 Number of Sequences: 5004 Number of extensions: 26208 Number of successful extensions: 61 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -