BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314B02f (436 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase... 24 2.7 L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase... 24 2.7 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 2.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 8.2 >L76433-1|AAC27659.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 23.8 bits (49), Expect = 2.7 Identities = 13/62 (20%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +1 Query: 124 QQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEE-ELIDYVHVLDKCVTKDLFK 300 Q+ L + D N W K+QE +++ + + + EE E + ++D ++++K Sbjct: 191 QKWLERTPGLEQDGFNFWGKFQESVEQLLAEQEASAMSEEHENVREYRLMDIDKRREVYK 250 Query: 301 RL 306 + Sbjct: 251 SI 252 >L76432-1|AAC27663.1| 392|Anopheles gambiae tryptophan oxygenase protein. Length = 392 Score = 23.8 bits (49), Expect = 2.7 Identities = 13/62 (20%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +1 Query: 124 QQSLREECSQKPDAQNMWAKYQECNDRVNSRSKTAETCEE-ELIDYVHVLDKCVTKDLFK 300 Q+ L + D N W K+QE +++ + + + EE E + ++D ++++K Sbjct: 191 QKWLERTPGLEQDGFNFWGKFQESVEQLLAEQEASAMSEEHENVREYRLMDIDKRREVYK 250 Query: 301 RL 306 + Sbjct: 251 SI 252 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 2.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 255 VNEFFFTGFCSFRSGVYTIIALLIFSPHVL 166 +N+F T F +Y II + I PH L Sbjct: 131 INKFISTSDKRFDEVIYNIIFMSIMVPHFL 160 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.2 bits (45), Expect = 8.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = -2 Query: 84 NHGNEFVRHFALYDPRAE 31 +H +EFVR ++ YDP A+ Sbjct: 1441 HHLDEFVRLWSEYDPDAK 1458 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,649 Number of Sequences: 2352 Number of extensions: 7323 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -