BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314A12f (493 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0E8X7 Cluster: CG30415-PA, isoform A; n=7; Endopterygo... 108 8e-23 UniRef50_UPI0000515741 Cluster: PREDICTED: similar to CG30415-PA... 85 6e-16 UniRef50_Q09JI6 Cluster: Conserved arthropod protein; n=2; Ixodo... 71 1e-11 UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; ... 37 0.21 UniRef50_UPI0000E4A3F9 Cluster: PREDICTED: similar to ankyrin 2,... 34 2.0 UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryo... 33 2.6 UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; ... 33 3.5 >UniRef50_Q0E8X7 Cluster: CG30415-PA, isoform A; n=7; Endopterygota|Rep: CG30415-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 82 Score = 108 bits (259), Expect = 8e-23 Identities = 44/71 (61%), Positives = 55/71 (77%) Frame = +3 Query: 51 GRPMKFPYTFSAKVAQFPYKFYLQNLWLWRYWAAAIVISSPLFYKIHKMSNSPENVSKWA 230 GRPM++PYTFSAK+AQFP K Y++N W+WRY+ A V P+FYKI K++NSPEN WA Sbjct: 12 GRPMRYPYTFSAKIAQFPIKHYIKNQWIWRYYFIAAVACVPVFYKISKLANSPENKKAWA 71 Query: 231 EIRRKEAAEHH 263 E + KE AEHH Sbjct: 72 ESQAKEHAEHH 82 >UniRef50_UPI0000515741 Cluster: PREDICTED: similar to CG30415-PA, isoform A; n=2; Apocrita|Rep: PREDICTED: similar to CG30415-PA, isoform A - Apis mellifera Length = 78 Score = 85.4 bits (202), Expect = 6e-16 Identities = 36/75 (48%), Positives = 54/75 (72%), Gaps = 4/75 (5%) Frame = +3 Query: 51 GRPMKFPYTFSAKVAQFPYKFYL---QNLWLWRYWAAAIVISSPLFYKIHKMSNSPENVS 221 GRPMKFPYT +AK+ +FP+ Y + W++RYWA +I+I +PL+YK ++S++PENV Sbjct: 3 GRPMKFPYTIAAKITRFPFHHYFVKSETGWVFRYWAISILICAPLWYKFQQLSHNPENVK 62 Query: 222 KWAEIRRKE-AAEHH 263 KW EI + + + E H Sbjct: 63 KWDEIHKHQFSGEMH 77 >UniRef50_Q09JI6 Cluster: Conserved arthropod protein; n=2; Ixodoidea|Rep: Conserved arthropod protein - Argas monolakensis Length = 102 Score = 71.3 bits (167), Expect = 1e-11 Identities = 36/82 (43%), Positives = 53/82 (64%), Gaps = 5/82 (6%) Frame = +3 Query: 33 TMSDAPGRPMKFPYTFSAKVAQFPYKFYLQNLWLWRYWAAAIVISSPLFY--KIHKMSNS 206 T S + R MK+PYT++AKVA FP++F +N+WL RY AI+++ +FY +H+ NS Sbjct: 21 TASSSTSRRMKYPYTWTAKVALFPHRFMFENVWLIRYSIPAIILTF-IFYVVPVHRAVNS 79 Query: 207 PENVSKWAEIRRKEA---AEHH 263 P ++ E RK+A AEHH Sbjct: 80 PSAIAAHEEFMRKQAEAEAEHH 101 >UniRef50_Q4Z0C1 Cluster: Putative uncharacterized protein; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 275 Score = 37.1 bits (82), Expect = 0.21 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 374 RGGARYPIRPIVSRIT 421 RGGARYPIRPIVSRIT Sbjct: 260 RGGARYPIRPIVSRIT 275 >UniRef50_UPI0000E4A3F9 Cluster: PREDICTED: similar to ankyrin 2,3/unc44; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ankyrin 2,3/unc44 - Strongylocentrotus purpuratus Length = 1763 Score = 33.9 bits (74), Expect = 2.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 33 TMSDAPGRPMKFPYTFSAKVAQFPYKFYLQNLWLWRYWAAAIVIS 167 T D P+K+ + A + F Y FY + +W W + +AA V S Sbjct: 1382 TYLDRNDHPLKYAVS-PASIDSFKYSFYPRTIWTWNHLSAAAVTS 1425 >UniRef50_UPI0000498F17 Cluster: beta-galactosidase; n=3; Eukaryota|Rep: beta-galactosidase - Entamoeba histolytica HM-1:IMSS Length = 86 Score = 33.5 bits (73), Expect = 2.6 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 425 HWPSFYNVVTGK 460 HWPSFYNVVTGK Sbjct: 5 HWPSFYNVVTGK 16 >UniRef50_A2VBJ9 Cluster: Non-ribosomal peptide synthetase; n=1; uncultured bacterium|Rep: Non-ribosomal peptide synthetase - uncultured bacterium Length = 338 Score = 33.1 bits (72), Expect = 3.5 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 416 YDSL*GELGTGPPLE 372 YDSL GELGTGPPLE Sbjct: 278 YDSLYGELGTGPPLE 292 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 501,241,401 Number of Sequences: 1657284 Number of extensions: 9666777 Number of successful extensions: 21853 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21846 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 28437262108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -