BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314A12f (493 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 1e-11 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 1e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 62 3e-10 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 62 3e-10 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 62 3e-10 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 59 2e-09 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 59 2e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 2e-09 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 2e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 52 3e-07 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 52 3e-07 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 51 5e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 42 2e-04 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.018 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.097 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.097 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.097 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.097 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) 33 0.17 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.30 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.90 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.90 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 30 1.2 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 30 1.2 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 30 1.2 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 30 1.2 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.2 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 30 1.2 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 30 1.2 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 30 1.2 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 30 1.2 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 30 1.2 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 30 1.2 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 30 1.2 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 30 1.2 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 30 1.2 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 29 2.1 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 29 2.8 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 29 2.8 SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) 29 2.8 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 28 3.6 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 4.8 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 28 4.8 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 8.4 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 27 8.4 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 27 8.4 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 27 8.4 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 27 8.4 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 27 8.4 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 27 8.4 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 27 8.4 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 8.4 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 27 8.4 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 27 8.4 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 27 8.4 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 27 8.4 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 27 8.4 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) 27 8.4 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 27 8.4 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 27 8.4 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 27 8.4 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 27 8.4 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 27 8.4 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 27 8.4 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 27 8.4 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 27 8.4 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 27 8.4 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 27 8.4 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 27 8.4 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 27 8.4 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 27 8.4 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 27 8.4 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 27 8.4 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) 27 8.4 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 27 8.4 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 27 8.4 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 27 8.4 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 27 8.4 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 27 8.4 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 27 8.4 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 27 8.4 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 8.4 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 27 8.4 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 27 8.4 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 27 8.4 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 27 8.4 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 27 8.4 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 27 8.4 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 27 8.4 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 27 8.4 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 27 8.4 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 27 8.4 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 27 8.4 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 27 8.4 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 27 8.4 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 27 8.4 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 27 8.4 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 27 8.4 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 27 8.4 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 27 8.4 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 27 8.4 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 SB_32290| Best HMM Match : BTP (HMM E-Value=8.7) 27 8.4 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.4 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 66.5 bits (155), Expect = 1e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -1 Query: 469 TPGFPSHDVVKRRPVNCNTTHYRANW 392 TPGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 TPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.3 bits (147), Expect = 1e-10 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -1 Query: 472 GTPGFPSHDVVKRRPVNCNTTHYRANW 392 G GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 54 GRSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 62.9 bits (146), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 469 TPGFPSHDVVKRRPVNCNTTHYRANW 392 TP FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1874 TPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRANW 392 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRANW 392 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRANW 392 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 36 GFPSHDVVKRRPVNCNTTHYRANW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRANW 392 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 79 GFPSHDVVKRRPVNCNTTHYRANW 102 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRANW 392 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 61.7 bits (143), Expect = 3e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRANW 392 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 460 FPSHDVVKRRPVNCNTTHYRANW 392 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANW 61 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 460 FPSHDVVKRRPVNCNTTHYRANW 392 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 460 FPSHDVVKRRPVNCNTTHYRANW 392 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -1 Query: 460 FPSHDVVKRRPVNCNTTHYRANW 392 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 45 FPSHDVVKRRPVNCNTTHYRANW 67 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 451 HDVVKRRPVNCNTTHYRANW 392 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 451 HDVVKRRPVNCNTTHYRANW 392 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 52.0 bits (119), Expect = 3e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -1 Query: 463 GFPSHDVVKRRPVNCNTTHYRAN 395 GFPSHD KRRPVNCNTTHYRAN Sbjct: 75 GFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 52.0 bits (119), Expect = 3e-07 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +2 Query: 371 TRGGARYPIRPIVSRITIHWPSFYNVVTGK 460 T GGA PIRPIVSRITIHWP+FYN TGK Sbjct: 34 TDGGA--PIRPIVSRITIHWPAFYNAPTGK 61 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 51.2 bits (117), Expect = 5e-07 Identities = 27/43 (62%), Positives = 28/43 (65%), Gaps = 4/43 (9%) Frame = +2 Query: 371 TRGGARYPIRPIVSRITIHWPSFYNVVTGKP----WRTNXSLR 487 T GGA PIRPIVS ITIHWPSFYN VT P WR + R Sbjct: 36 TVGGA--PIRPIVSHITIHWPSFYNGVTAHPPFASWRNSEEAR 76 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 51.2 bits (117), Expect = 5e-07 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = -1 Query: 460 FPSHDVVKRRPVNCNTTHYRAN 395 F SHDVVKRRPVNCNTTHYRAN Sbjct: 19 FRSHDVVKRRPVNCNTTHYRAN 40 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = +2 Query: 395 IRPIVSRITIHWPSFYNVVTGK 460 +RP+VSRITIHW SFYNVVTGK Sbjct: 33 LRPVVSRITIHWTSFYNVVTGK 54 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.2 bits (102), Expect = 3e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +2 Query: 401 PIVSRITIHWPSFYNVVTGK 460 P +SRITIHWPSFYNVVTGK Sbjct: 77 PYMSRITIHWPSFYNVVTGK 96 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNVVTGK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 395 IRPIVSRITIHWPSFY 442 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.3 bits (80), Expect = 0.014 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +2 Query: 410 SRITIHWPSFYNVVTGK 460 SRITIHWPSFYNV+ K Sbjct: 2 SRITIHWPSFYNVMLAK 18 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.018 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 410 SRITIHWPSFYNVV 451 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 33.5 bits (73), Expect = 0.097 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 425 HWPSFYNVVTGK 460 HWPSFYNVVTGK Sbjct: 5 HWPSFYNVVTGK 16 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 33.5 bits (73), Expect = 0.097 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 425 HWPSFYNVVTGK 460 HWPSFYNVVTGK Sbjct: 62 HWPSFYNVVTGK 73 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.5 bits (73), Expect = 0.097 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 425 HWPSFYNVVTGK 460 HWPSFYNVVTGK Sbjct: 5 HWPSFYNVVTGK 16 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.5 bits (73), Expect = 0.097 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 425 HWPSFYNVVTGK 460 HWPSFYNVVTGK Sbjct: 57 HWPSFYNVVTGK 68 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPV 425 GFPSHDVVKRRPV Sbjct: 55 GFPSHDVVKRRPV 67 >SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) Length = 444 Score = 32.7 bits (71), Expect = 0.17 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 463 GFPSHDVVKRRPV 425 GFPSHDVVKRRPV Sbjct: 217 GFPSHDVVKRRPV 229 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 31.9 bits (69), Expect = 0.30 Identities = 16/20 (80%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = -3 Query: 476 SWYARV-SQSRRCKTTASEL 420 SW V SQSRRCKTTASEL Sbjct: 30 SWVTPVFSQSRRCKTTASEL 49 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 30.7 bits (66), Expect = 0.68 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = +2 Query: 425 HWPSFYNVVTGK 460 HWPSFYN VTGK Sbjct: 5 HWPSFYNDVTGK 16 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 30.3 bits (65), Expect = 0.90 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 460 FPSHDVVKRRPV 425 FPSHDVVKRRPV Sbjct: 14 FPSHDVVKRRPV 25 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.3 bits (65), Expect = 0.90 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -1 Query: 460 FPSHDVVKRRPV 425 FPSHDVVKRRPV Sbjct: 14 FPSHDVVKRRPV 25 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 257 SQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 925 SQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 37 SQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 412 SQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 261 SQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 328 SQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 394 SQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 86 SQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 68 SQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 304 SQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 288 SQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 277 SQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 302 SQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 486 SQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 155 SQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 321 SQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 171 SQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 364 SQSRRCKTTASEL 376 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 45 SQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 31 SQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 230 SQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 622 SQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 258 SQSRRCKTTASEL 270 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 67 SQSRRCKTTASEL 79 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 98 SQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 536 SQSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 38 SQSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 119 SQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 427 SQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 31 SQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 29.9 bits (64), Expect = 1.2 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 458 SQSRRCKTTASEL 420 SQSRRCKTTASEL Sbjct: 220 SQSRRCKTTASEL 232 >SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 427 LAVVLQRRDWETLAYQLI 480 LAVVLQRRDWE L+ Sbjct: 542 LAVVLQRRDWENTGVSLV 559 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -3 Query: 458 SQSRRCKTTASEL*YDSL 405 SQSRRCKTTASE D L Sbjct: 45 SQSRRCKTTASEFPGDPL 62 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 85 LAVVLQRRDWE 95 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +1 Query: 346 LXXKKXKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWE 459 L K N RG P+ LAVVLQRRDWE Sbjct: 504 LRFPKESANQRGDPLESTCRHASLA--LAVVLQRRDWE 539 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +1 Query: 322 SNNKIMG*LXXKKXKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWE 459 SN+K K+ + N P LAVVLQRRDWE Sbjct: 1438 SNDKAEEEASTKEERVNDHRIPAARGIHYESYYNSLAVVLQRRDWE 1483 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +1 Query: 358 KXKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWE 459 K K ++RG P+ LAVVLQRRDWE Sbjct: 34 KRKLSNRGDPLESTCRHASLA--LAVVLQRRDWE 65 >SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) Length = 508 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/48 (37%), Positives = 22/48 (45%) Frame = -1 Query: 469 TPGFPSHDVVKRRPVNCNTTHYRANWVPGPPSSXXXXXXXXTSP*FYY 326 T F SHDVVKRRPV + H + + PP T +YY Sbjct: 406 TNSFISHDVVKRRPV--PSLHACRSTLEDPPIDTTTPIDTTTRYRYYY 451 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = +3 Query: 48 PGRPMKFPYTFSAKVAQFPYKFYLQNLWLWRYWAAAIVISSP 173 PG P P+ + K + + F W W Y+ A+ + P Sbjct: 183 PGMPAAQPFVHAFKESNAAWNFCPAGKWSWEYYDASAEVPPP 224 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 458 SQSRRCKTTASE 423 SQSRRCKTTASE Sbjct: 567 SQSRRCKTTASE 578 >SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/18 (77%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -3 Query: 476 SWYARV-SQSRRCKTTAS 426 SW V SQSRRCKTTAS Sbjct: 31 SWVTPVFSQSRRCKTTAS 48 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 27.9 bits (59), Expect = 4.8 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +1 Query: 367 KNSRGGPVXXXXXXXXXXXXLAVVLQRRDWE 459 K SRG P+ LAVVLQRRDWE Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWE 843 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 27.9 bits (59), Expect = 4.8 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +1 Query: 355 KKXKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWE 459 K K+ S+G LAVVLQRRDWE Sbjct: 1166 KAGKRRSQGKGDPLESTCRHASLALAVVLQRRDWE 1200 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +1 Query: 310 IYVVSNNKIMG*LXXKKXKK---NSRGGPVXXXXXXXXXXXXLAVVLQRRDWE 459 +Y+V N + G L + K+ G P+ LAVVLQRRDWE Sbjct: 9 VYIVKKNNLHGPLYPFEIKELVLAKYGDPLESTCRHASLA--LAVVLQRRDWE 59 >SB_46536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 427 LAVVLQRRDWETLAYQLI 480 LAVVLQRRDWE ++ Sbjct: 59 LAVVLQRRDWENTGVAML 76 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 35 LAVVLQRRDWE 45 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 62 LAVVLQRRDWE 72 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 44 LAVVLQRRDWE 54 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 36 LAVVLQRRDWE 46 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 62 LAVVLQRRDWE 72 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 42 LAVVLQRRDWE 52 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 67 LAVVLQRRDWE 77 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 38 LAVVLQRRDWE 48 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 58 LAVVLQRRDWE 68 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 70 LAVVLQRRDWE 80 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 46 LAVVLQRRDWE 56 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 35 LAVVLQRRDWE 45 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 25 LAVVLQRRDWE 35 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 50 LAVVLQRRDWE 60 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 59 LAVVLQRRDWE 69 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 53 LAVVLQRRDWE 63 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 69 LAVVLQRRDWE 79 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 57 LAVVLQRRDWE 67 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 40 LAVVLQRRDWE 50 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 216 LAVVLQRRDWE 226 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 111 LAVVLQRRDWE 121 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 49 LAVVLQRRDWE 59 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 28 LAVVLQRRDWE 38 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 16 LAVVLQRRDWE 26 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 47 LAVVLQRRDWE 57 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 381 LAVVLQRRDWE 391 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 107 LAVVLQRRDWE 117 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 83 LAVVLQRRDWE 93 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 39 LAVVLQRRDWE 49 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 8 LAVVLQRRDWE 18 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 18 LAVVLQRRDWE 28 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 38 LAVVLQRRDWE 48 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 103 LAVVLQRRDWE 113 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 45 LAVVLQRRDWE 55 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 340 LAVVLQRRDWE 350 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 80 LAVVLQRRDWE 90 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 50 LAVVLQRRDWE 60 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 16 LAVVLQRRDWE 26 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 59 LAVVLQRRDWE 69 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 43 LAVVLQRRDWE 53 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 134 LAVVLQRRDWE 144 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 63 LAVVLQRRDWE 73 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 39 LAVVLQRRDWE 49 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 143 LAVVLQRRDWE 153 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 16 LAVVLQRRDWE 26 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 60 LAVVLQRRDWE 70 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 34 LAVVLQRRDWE 44 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 73 LAVVLQRRDWE 83 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 35 LAVVLQRRDWE 45 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 67 LAVVLQRRDWE 77 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 56 LAVVLQRRDWE 66 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 69 LAVVLQRRDWE 79 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 256 LAVVLQRRDWE 266 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 114 LAVVLQRRDWE 124 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 50 LAVVLQRRDWE 60 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 36 LAVVLQRRDWE 46 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 37 LAVVLQRRDWE 47 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 101 LAVVLQRRDWE 111 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 114 LAVVLQRRDWE 124 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 39 LAVVLQRRDWE 49 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 20 LAVVLQRRDWE 30 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 58 LAVVLQRRDWE 68 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 37 LAVVLQRRDWE 47 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 34 LAVVLQRRDWE 44 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 11 LAVVLQRRDWE 21 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 19 LAVVLQRRDWE 29 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 396 LAVVLQRRDWE 406 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 45 LAVVLQRRDWE 55 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 54 LAVVLQRRDWE 64 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 36 LAVVLQRRDWE 46 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 119 LAVVLQRRDWE 129 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 55 LAVVLQRRDWE 65 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 65 LAVVLQRRDWE 75 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 68 LAVVLQRRDWE 78 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 414 LAVVLQRRDWE 424 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 111 LAVVLQRRDWE 121 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 67 LAVVLQRRDWE 77 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 56 LAVVLQRRDWE 66 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 46 LAVVLQRRDWE 56 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 49 LAVVLQRRDWE 59 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 161 LAVVLQRRDWE 171 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 65 LAVVLQRRDWE 75 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 52 LAVVLQRRDWE 62 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 88 LAVVLQRRDWE 98 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 54 LAVVLQRRDWE 64 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 37 LAVVLQRRDWE 47 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 63 LAVVLQRRDWE 73 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 42 LAVVLQRRDWE 52 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 185 LAVVLQRRDWE 195 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 34 LAVVLQRRDWE 44 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 40 LAVVLQRRDWE 50 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 54 LAVVLQRRDWE 64 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 51 LAVVLQRRDWE 61 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_52419| Best HMM Match : Drf_DAD (HMM E-Value=2.5) Length = 146 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 56 LAVVLQRRDWE 66 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 34 LAVVLQRRDWE 44 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 35 LAVVLQRRDWE 45 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 49 LAVVLQRRDWE 59 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 39 LAVVLQRRDWE 49 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 132 LAVVLQRRDWE 142 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 41 LAVVLQRRDWE 51 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 84 LAVVLQRRDWE 94 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 22 LAVVLQRRDWE 32 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 153 LAVVLQRRDWE 163 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 340 LAVVLQRRDWE 350 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) Length = 181 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 90 LAVVLQRRDWE 100 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 57 LAVVLQRRDWE 67 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 21 LAVVLQRRDWE 31 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 109 LAVVLQRRDWE 119 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 86 LAVVLQRRDWE 96 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 36 LAVVLQRRDWE 46 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 60 LAVVLQRRDWE 70 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 294 LAVVLQRRDWE 304 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 57 LAVVLQRRDWE 67 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 58 LAVVLQRRDWE 68 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 16 LAVVLQRRDWE 26 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 36 LAVVLQRRDWE 46 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 411 LAVVLQRRDWE 421 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 95 LAVVLQRRDWE 105 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 51 LAVVLQRRDWE 61 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 43 LAVVLQRRDWE 53 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 29 LAVVLQRRDWE 39 >SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 42 LAVVLQRRDWE 52 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 93 LAVVLQRRDWE 103 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 43 LAVVLQRRDWE 53 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +1 Query: 427 LAVVLQRRDWE 459 LAVVLQRRDWE Sbjct: 211 LAVVLQRRDWE 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,465,953 Number of Sequences: 59808 Number of extensions: 304048 Number of successful extensions: 3550 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3546 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1050596726 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -