BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314A11f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 1.6 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.2 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.2 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 3.8 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 3.8 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 8.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.0 bits (47), Expect = 1.6 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 372 HLQGRSYHISALYVVDLKRFRRIAAGDRLRGQYQALSQDPNSL 500 HLQ ++LY +D FR L + +S+ PN L Sbjct: 273 HLQVLDLSHNSLYELDFDTFRNTKKLQWLDTSHNRISEIPNDL 315 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 72 LSTNGAPPRSTPPLSTPSNS 91 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 319 LSQNGV*PYGAPPKSNSTNS 260 LS NG P PP S +NS Sbjct: 116 LSTNGAPPRSTPPLSTPSNS 135 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 21.8 bits (44), Expect = 3.8 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -2 Query: 238 WSASTKIIFLTCSGNNTSRNRILYPQMVRCR 146 W +T T + SRN YP + CR Sbjct: 32 WQCNTDEETCTRISSTVSRNTDTYPTLETCR 62 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 3.8 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 339 FRFWKQGYWRNHL 377 + FWK+ YW L Sbjct: 72 YNFWKKKYWSEFL 84 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 20.6 bits (41), Expect = 8.7 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -2 Query: 208 TCSGNNTSRNRILYPQMVRCRSRWRCSQRGHWYWTSSYSNPY 83 TC R+R L + R + S+ + Y+ S SNPY Sbjct: 216 TCEAVMILRSRFLDARRKRRNFSKQASEILNEYFYSHLSNPY 257 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,569 Number of Sequences: 336 Number of extensions: 2369 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -