BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314A10f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 27 0.29 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 4.7 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 6.2 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 27.5 bits (58), Expect = 0.29 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 69 EAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 197 + G Q S+G+G+ +P + G G +SG +FGN +GG Sbjct: 121 QGGGQGGIPSFGSGQQNGGVPFL-GNGQGQSGFPSFGNGQQGG 162 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 4.7 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -3 Query: 177 RRHPDRTYEYHHHGH 133 ++HP + +HHH H Sbjct: 175 QQHPGHSQHHHHHHH 189 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -3 Query: 180 YRRHPDRTYEYHHH--GHAEFGRQHVQYPMIQ 91 + HP + +HHH A+ H Q+ +IQ Sbjct: 498 HHAHPHHHHHHHHHHPTAADLAGYHHQHNVIQ 529 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 519,700 Number of Sequences: 2352 Number of extensions: 10225 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -