BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314A02f (453 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U73822-1|AAC47449.1| 300|Drosophila melanogaster wunen protein. 30 1.3 BT001729-1|AAN71484.1| 379|Drosophila melanogaster RE70417p pro... 30 1.3 AF145595-1|AAD38570.1| 300|Drosophila melanogaster wun protein. 30 1.3 AE013599-858|AAM71066.1| 300|Drosophila melanogaster CG8804-PA,... 30 1.3 AE013599-857|AAF58942.2| 379|Drosophila melanogaster CG8804-PB,... 30 1.3 >U73822-1|AAC47449.1| 300|Drosophila melanogaster wunen protein. Length = 300 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 162 YSFFFLKNLLKYSILYARTFWRGSKMLSYVSCFIYLL 272 ++FF + L Y L AR WRGSK+L ++ F++++ Sbjct: 195 FTFFAMVYLALY--LQARMTWRGSKLLRHLLQFLFIM 229 >BT001729-1|AAN71484.1| 379|Drosophila melanogaster RE70417p protein. Length = 379 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 162 YSFFFLKNLLKYSILYARTFWRGSKMLSYVSCFIYLL 272 ++FF + L Y L AR WRGSK+L ++ F++++ Sbjct: 274 FTFFAMVYLALY--LQARMTWRGSKLLRHLLQFLFIM 308 >AF145595-1|AAD38570.1| 300|Drosophila melanogaster wun protein. Length = 300 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 162 YSFFFLKNLLKYSILYARTFWRGSKMLSYVSCFIYLL 272 ++FF + L Y L AR WRGSK+L ++ F++++ Sbjct: 195 FTFFAMVYLALY--LQARMTWRGSKLLRHLLQFLFIM 229 >AE013599-858|AAM71066.1| 300|Drosophila melanogaster CG8804-PA, isoform A protein. Length = 300 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 162 YSFFFLKNLLKYSILYARTFWRGSKMLSYVSCFIYLL 272 ++FF + L Y L AR WRGSK+L ++ F++++ Sbjct: 195 FTFFAMVYLALY--LQARMTWRGSKLLRHLLQFLFIM 229 >AE013599-857|AAF58942.2| 379|Drosophila melanogaster CG8804-PB, isoform B protein. Length = 379 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 162 YSFFFLKNLLKYSILYARTFWRGSKMLSYVSCFIYLL 272 ++FF + L Y L AR WRGSK+L ++ F++++ Sbjct: 274 FTFFAMVYLALY--LQARMTWRGSKLLRHLLQFLFIM 308 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,341,183 Number of Sequences: 53049 Number of extensions: 310497 Number of successful extensions: 410 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1476622287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -