BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS314A02f (453 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 6.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 6.3 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.3 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -3 Query: 190 NRFLRKKKEY*EHSLRGLFKPEFSIQSVRADSNI 89 NRF+ + E L+ ++ FS+ + D+ I Sbjct: 207 NRFINENSELLFKELQAAYEETFSLVFTKIDNEI 240 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.0 bits (42), Expect = 6.3 Identities = 15/54 (27%), Positives = 21/54 (38%) Frame = +1 Query: 259 LFTYLSFSLDLSMQQ*FYSVTTVTAHKTGNINKITGYGLTGFFQKALRAHFNLS 420 L + SF +D S+ + FY T N+ TG Q H NL+ Sbjct: 359 LHNHQSFGMDFSLNEDFYPTFNQTNVDQYLYNQTGPLSSTGLAQVTGIWHSNLT 412 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 20.6 bits (41), Expect = 8.3 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +2 Query: 158 LIFLFFSQKSIEIQHS-LCPYFLAGKQDV 241 LI+ FF S IQH P LA K ++ Sbjct: 336 LIYDFFKDSSFRIQHHFFYPDPLASKYEL 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,824 Number of Sequences: 438 Number of extensions: 1977 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -