BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313G12f (327 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosec... 21 5.0 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 20 6.6 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 20 6.6 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 20 6.6 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 20 6.6 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 20 8.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 20 8.8 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 20 8.8 >M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosecapin mRNA, complete cds. ). Length = 77 Score = 20.6 bits (41), Expect = 5.0 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 Query: 54 LVRPSRCEAAERGRRT 101 L+ PS+CEA R++ Sbjct: 24 LIIPSKCEAVSNDRQS 39 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 20.2 bits (40), Expect = 6.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 99 FDDPVRPLHTVTDEREKNTTLYLKYRVFII 10 F DP+ P+H T YL R I+ Sbjct: 155 FKDPLIPVHFALRIYRNGTVNYLMRRHLIL 184 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 20.2 bits (40), Expect = 6.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 99 FDDPVRPLHTVTDEREKNTTLYLKYRVFII 10 F DP+ P+H T YL R I+ Sbjct: 155 FKDPLIPVHFALRIYRNGTVNYLMRRHLIL 184 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 20.2 bits (40), Expect = 6.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 99 FDDPVRPLHTVTDEREKNTTLYLKYRVFII 10 F DP+ P+H T YL R I+ Sbjct: 206 FKDPLIPVHFALRIYRNGTVNYLMRRHLIL 235 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 20.2 bits (40), Expect = 6.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 99 FDDPVRPLHTVTDEREKNTTLYLKYRVFII 10 F DP+ P+H T YL R I+ Sbjct: 155 FKDPLIPVHFALRIYRNGTVNYLMRRHLIL 184 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 19.8 bits (39), Expect = 8.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 179 PRRNCWS*IRSRVRPATI 126 P RN RS VRPAT+ Sbjct: 327 PMRNDSERNRSPVRPATV 344 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 19.8 bits (39), Expect = 8.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -2 Query: 194 TLILDPRRNC 165 TLIL PR+ C Sbjct: 461 TLILPPRKRC 470 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 19.8 bits (39), Expect = 8.8 Identities = 10/46 (21%), Positives = 20/46 (43%) Frame = +1 Query: 148 DRIHDQQLRRGSSIKVNQT*NSRSILYLLLQHYQTCYNSRKYELCL 285 ++++ ++ +S +VN I+ L C N K +CL Sbjct: 73 EKLNQLEIESDNSKEVNDKKEENFIVDRLRNDLFECENKEKSNVCL 118 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,906 Number of Sequences: 438 Number of extensions: 1385 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7217694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -