BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313G08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 30 1.3 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 29 2.3 SB_58027| Best HMM Match : zf-C4 (HMM E-Value=0) 29 3.1 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) 28 4.1 SB_153| Best HMM Match : Pox_TAA1 (HMM E-Value=5) 28 4.1 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 9.4 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 55.6 bits (128), Expect = 2e-08 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +2 Query: 50 SVKVHPVVLFQIVDAYERRN--ADSHRVIGTLLGTSDKGVVEVTNCFCVPHKE-HADQVE 220 +V VHP+VL +VD + R RV+G LLG+ KGV++V NCF VP E DQ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNV 69 Query: 221 --AELNYAMDVYELNRRVN 271 + +Y ++Y + ++VN Sbjct: 70 WFLDHDYLENMYAMFKKVN 88 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 48.8 bits (111), Expect = 3e-06 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +2 Query: 53 VKVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVP-HKEHADQVEAEL 229 V+V + + +I+ E + V G LLG +E+TNCF P +K D+ + ++ Sbjct: 18 VQVDGLTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDV 77 Query: 230 NYAMDVYELNRRVNSSESIVGWW 298 NY M+V R VN VGW+ Sbjct: 78 NYQMEVMRRLRAVNIDHLHVGWY 100 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.5 bits (68), Expect = 0.44 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 215 VEAELNYAMDVYELNRRVNSSESIVG 292 V EL YA +YEL+++ N +E IVG Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVG 26 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 46 Y*CKGPSCCFISNCGRIRTSKCRF 117 Y C+G + CFI R R KCRF Sbjct: 76 YTCRGSNDCFIDKVHRNRCQKCRF 99 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -1 Query: 284 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 105 Y+ + CS + PSR +P R R + +R+ W++ +CR P R L ++F Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP-RSSNLHNYINF 92 Query: 104 DVRMRPQFEIK 72 R F+ K Sbjct: 93 GRLRRRYFDSK 103 >SB_58027| Best HMM Match : zf-C4 (HMM E-Value=0) Length = 396 Score = 28.7 bits (61), Expect = 3.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 34 NGSQY*CKGPSCCFISNCGRIRTSKCRFSQ 123 N + Y C+G + C I R R CRF + Sbjct: 87 NNTNYTCRGQNTCAIDRNSRSRCPSCRFQK 116 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -1 Query: 284 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 105 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P R L ++F Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP-RSSNLHNYINF 146 Query: 104 D-VRMRP 87 +R RP Sbjct: 147 GRLRRRP 153 >SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) Length = 270 Score = 28.3 bits (60), Expect = 4.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 379 YSGHFTGWRSNGFTCICL 432 ++GH W SNG TC+ L Sbjct: 201 FNGHTYSWHSNGVTCVLL 218 >SB_153| Best HMM Match : Pox_TAA1 (HMM E-Value=5) Length = 139 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 17 FLVEFKMALNISVKVHPVVLFQIV 88 F E K ALN+S+KV P++ ++V Sbjct: 80 FYTESKRALNMSIKVGPIIATEVV 103 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 370 CPCYSGHFTGWRSNGFTCIC 429 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 370 CPCYSGHFTGWRSNGFTCIC 429 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 >SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 979 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = +2 Query: 161 VVEVTNCFCVPHKEHADQVEAELNYAMDVYELN----RRVNSSESIVG 292 ++ + +C + HKEHAD+ E++ A+ ++ LN R + + E VG Sbjct: 706 IIALNSCRVMLHKEHADE-ESDYINAVFLHRLNSFTSREIPAEEKSVG 752 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,787,901 Number of Sequences: 59808 Number of extensions: 392210 Number of successful extensions: 1449 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1335 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1447 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -