BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313G04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6930| Best HMM Match : FAD_binding_7 (HMM E-Value=0) 28 5.4 SB_13421| Best HMM Match : Harpin (HMM E-Value=0.62) 27 7.1 >SB_6930| Best HMM Match : FAD_binding_7 (HMM E-Value=0) Length = 506 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 255 LEVLWRRQKKSHNDPEIRVHG 193 LEV +++KK H+ P + +HG Sbjct: 240 LEVYMKKEKKKHSQPPVSLHG 260 >SB_13421| Best HMM Match : Harpin (HMM E-Value=0.62) Length = 375 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -3 Query: 318 VISSYTKIFWGNN*KSSPTAALEVLWRRQKKSHNDPEIRVHGDKSFKT 175 ++ + ++ WG+ KS A+L+ KSH ++ HG S K+ Sbjct: 71 LLGQHPQVSWGSIPKSHGAASLKSHGGASLKSHGAASLKSHGAASLKS 118 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,684,817 Number of Sequences: 59808 Number of extensions: 254949 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 475 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -