BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313G01f (476 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 5.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 9.0 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 5.1 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 342 AKKPESDDEKKRKSKWDQAAPNIGSKPNIKQPG 244 +KK ESDD+K SK GSK N PG Sbjct: 338 SKKKESDDKKVISSK-------SGSKANSPFPG 363 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.6 bits (41), Expect = 9.0 Identities = 11/46 (23%), Positives = 21/46 (45%) Frame = +3 Query: 42 HLFNIFLRQIYL*DYNCISVHLMIIIQHLQLNDVSHIRSLVFLVKI 179 +LF + R I N + + IQH +++ SH ++K+ Sbjct: 43 YLFCDYDRDIIPEQKNATKIDFGLSIQHYNVDEYSHTVDFHVMLKL 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,832 Number of Sequences: 438 Number of extensions: 1090 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -