BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313F12f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324,874... 29 1.7 03_05_0621 - 26198985-26199020,26199539-26199652,26200260-262006... 28 4.0 12_02_0390 - 18510095-18510148,18510318-18512450,18513018-185136... 27 9.1 >03_02_0473 + 8745721-8745994,8746083-8746090,8746232-8746324, 8746665-8746893,8747314-8747420,8747560-8747622, 8747883-8747983,8748996-8749090,8749330-8749350, 8749987-8750082,8750188-8750308,8750415-8750570, 8750679-8750869,8751207-8751478,8751853-8751954, 8752006-8752038,8752132-8752308,8752397-8752466, 8752512-8752585,8752667-8752908,8752983-8753129, 8753526-8753751,8753893-8753970,8754378-8754521, 8754829-8755008,8755335-8755394,8755484-8755523, 8758653-8759137 Length = 1294 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -2 Query: 415 LSQQGIANSLAYTIAAYEILLNLRSY-NNILTLFSRLNVTS 296 + + G + + AY++ AY+ NL+SY +N+ +L S LN S Sbjct: 475 VQEMGKSRAAAYSLGAYDEAANLQSYSDNVESLDSDLNENS 515 >03_05_0621 - 26198985-26199020,26199539-26199652,26200260-26200623, 26201232-26201527 Length = 269 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -3 Query: 201 IINVFSFQKSEHGKISCLGVTS 136 ++N+ + Q S G+ISCLG++S Sbjct: 222 VLNLGNLQNSHEGRISCLGLSS 243 >12_02_0390 - 18510095-18510148,18510318-18512450,18513018-18513681, 18514089-18514202,18514835-18514979,18515274-18515331 Length = 1055 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 303 LHHIERDIIFSVISNNGREKN 241 +H + RD+ ++SN GR+KN Sbjct: 584 MHDVIRDMALWIVSNEGRDKN 604 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,555,370 Number of Sequences: 37544 Number of extensions: 184219 Number of successful extensions: 271 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 267 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -