BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313F12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 24 2.7 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 4.7 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 4.7 AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse t... 23 6.2 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -3 Query: 348 YALTTIFLLYLVDLMLHHIERDIIFSVISNNGREKNVT 235 Y L + +Y + LM+ +I ISN REK + Sbjct: 243 YNLFCVIAMYFLPLMIISGAYTVILCEISNRSREKETS 280 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 4.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 153 CLGVTSITLAELSSQFVRIT*EFEQNLS 70 C G++ T A S F R+T EQN+S Sbjct: 392 CSGISGSTTAIGGSVFTRLTTVEEQNVS 419 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 23.4 bits (48), Expect = 4.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 153 CLGVTSITLAELSSQFVRIT*EFEQNLS 70 C G++ T A S F R+T EQN+S Sbjct: 392 CSGISGSTTAIGGSVFTRLTTVEEQNVS 419 >AJ970250-1|CAI96722.1| 132|Anopheles gambiae putative reverse transcriptase protein. Length = 132 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 Query: 161 FPCSDF*KLKTLIMQVSYALGIERHVT 241 FPCS LK+ ++ +Y + I++H++ Sbjct: 93 FPCSLVQWLKSYLINRTYIVKIDKHMS 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,724 Number of Sequences: 2352 Number of extensions: 7942 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -