BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313F08f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.05 |nse1||Smc5-6 complex non-SMC subunit 1|Schizosacchar... 28 0.73 SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe... 25 6.8 SPCC1235.12c |mug146||meiotically upregulated gene Mug46|Schizos... 25 9.0 >SPCC550.05 |nse1||Smc5-6 complex non-SMC subunit 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 232 Score = 28.3 bits (60), Expect = 0.73 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 456 EKNNSVHSFGFSF*GVSRIAEGRSHIHTSLV*YQPVSQ 343 E NNS+H+F F V +GR +H + PVSQ Sbjct: 52 ELNNSLHNFDFKIKRVQDQLDGRLTLHFQNLSGDPVSQ 89 >SPAC7D4.03c |||conserved fungal family|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/31 (35%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 164 RWREYGDGFLVLKFTSCHHSF-SFEYTYEKP 253 R++ GF +F SC+HSF + ++++E P Sbjct: 368 RFKSSTGGFF-FEFLSCYHSFLALQFSFELP 397 >SPCC1235.12c |mug146||meiotically upregulated gene Mug46|Schizosaccharomyces pombe|chr 3|||Manual Length = 311 Score = 24.6 bits (51), Expect = 9.0 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -3 Query: 408 SRIAEGRSHIHTSLV*YQPVSQ*QLLFLNKNHERLSKVLLVITHKVTKQKN 256 +++ + R H + +L P + F N+N RLS+V +TH ++ +N Sbjct: 13 TQVRKERVHTYRTLTSATPSLE---FFSNENTNRLSEVQCKLTHFLSSSEN 60 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,989,591 Number of Sequences: 5004 Number of extensions: 38435 Number of successful extensions: 80 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -