BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313F04f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 25 0.54 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 25 0.54 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 25 0.54 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 21 8.7 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 24.6 bits (51), Expect = 0.54 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 396 VCTKYVVVLIIFE-FDFISHKSLFGQFSLLSHTI 494 V T +VVL+ +E FD + +KS QF LLS I Sbjct: 96 VVTTVLVVLVGYERFDILLNKSKNLQFPLLSTLI 129 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 24.6 bits (51), Expect = 0.54 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 396 VCTKYVVVLIIFE-FDFISHKSLFGQFSLLSHTI 494 V T +VVL+ +E FD + +KS QF LLS I Sbjct: 96 VVTTVLVVLVGYERFDILLNKSKNLQFPLLSTLI 129 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 24.6 bits (51), Expect = 0.54 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 396 VCTKYVVVLIIFE-FDFISHKSLFGQFSLLSHTI 494 V T +VVL+ +E FD + +KS QF LLS I Sbjct: 96 VVTTVLVVLVGYERFDILLNKSKNLQFPLLSTLI 129 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 446 NKIKLKNNENY 414 NK+KL NE+Y Sbjct: 150 NKLKLNTNESY 160 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,090 Number of Sequences: 336 Number of extensions: 1809 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -