BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313F03f (466 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 31 0.11 SPAC1D4.02c |||human GRASP protein homolog |Schizosaccharomyces ... 25 4.3 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 25 4.3 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 30.7 bits (66), Expect = 0.11 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 459 GFSGFFPQGKGPPPHPNGSIFXGXKGFG 376 GF GF GPPP P G F G GFG Sbjct: 189 GFGGFGGGSGGPPPGPGG--FGGFGGFG 214 >SPAC1D4.02c |||human GRASP protein homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.4 bits (53), Expect = 4.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = -2 Query: 429 GPPPHPNGSIFXGXKGFGPPXKNSXQRPLXNF 334 GPPP P +F GP K S NF Sbjct: 216 GPPPQPGDIVFSNPMLGGPDHKVSQPSETENF 247 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 25.4 bits (53), Expect = 4.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 425 PPPTPMVQFXXGKRXLAPRXKIAPKGP 345 PPP PM G AP + P GP Sbjct: 1883 PPPPPMALPKAGPPSAAPTSALPPAGP 1909 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,449,159 Number of Sequences: 5004 Number of extensions: 23037 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -