BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E12f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.1 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 24 1.1 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 24 1.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 1.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 1.1 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 23 2.5 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 7.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 7.7 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.7 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.7 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.7 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.7 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.7 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 69 NRTERERSKEPKIISNNNSLSNN 91 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 302 NRTERERSKEPKIISNNNSLSNN 324 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.8 bits (49), Expect = 1.1 Identities = 8/23 (34%), Positives = 16/23 (69%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + +LS N Sbjct: 302 NRTERERSKEPKIISNNNSLSNN 324 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGNLSEN 120 NR+E+ ++++PK + LS N Sbjct: 69 NRTERERSKEPKIISNNNPLSNN 91 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/37 (21%), Positives = 18/37 (48%) Frame = +2 Query: 35 DISQSQIEANNGRRKTQNNSMRQETYQRTLEYVENCE 145 D+ Q+E +N +RQ +++ +++CE Sbjct: 354 DLPSDQVEPDNSSNFAMKPLVRQPEDTMSVDRMQHCE 390 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/37 (21%), Positives = 18/37 (48%) Frame = +2 Query: 35 DISQSQIEANNGRRKTQNNSMRQETYQRTLEYVENCE 145 D+ Q+E +N +RQ +++ +++CE Sbjct: 354 DLPSDQVEPDNSSNFAMKPLVRQPEDTMSVDRMQHCE 390 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 69 NRTEREKSKEPKIISSLSN 87 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 69 NRTEREKSKEPKIISSLSN 87 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 69 NRTEREKSKEPKIISSLSN 87 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 69 NRTEREKSKEPKIISSLSN 87 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 302 NRTEREKSKEPKIISSLSN 320 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 302 NRTEREKSKEPKIISSLSN 320 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 302 NRTEREKSKEPKIISSLSN 320 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 302 NRTEREKSKEPKIISSLSN 320 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 302 NRTEREKSKEPKIISSLSN 320 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +1 Query: 52 NRSEQRKTEDPKQFNETGN 108 NR+E+ K+++PK + N Sbjct: 291 NRTEREKSKEPKIISSLSN 309 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,215 Number of Sequences: 438 Number of extensions: 3203 Number of successful extensions: 26 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -