BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-tran... 26 0.67 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 25 1.5 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 24 2.7 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 3.6 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 23 6.2 >AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-transferase u3 protein. Length = 218 Score = 26.2 bits (55), Expect = 0.67 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 393 IKGEQCSITELCNFTNLKDVKSV 461 I GE+C++ +LC N+ +K + Sbjct: 151 IAGEECTLADLCALANVATLKEI 173 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/68 (20%), Positives = 28/68 (41%) Frame = +3 Query: 270 LSLTKNITQSLSKFGIEKSHDLLVCFLVTNEIDCRPEILPEIKGEQCSITELCNFTNLKD 449 +S+ +N +++ F H F + N+ + L +I+ + LC F Sbjct: 82 ISIYRNNERAVRWFSRSFDHSAKSTFEIDNQTVSQQAYLQQIRAFNIQVDNLCQFLPQDR 141 Query: 450 VKSVYKLN 473 V+ K+N Sbjct: 142 VQDFTKMN 149 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 24.2 bits (50), Expect = 2.7 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +1 Query: 181 KWLWRRTEQLSQRNLVQWLRELCSE 255 K++W R ++ RNL+ + + C E Sbjct: 297 KFMWERIDRSESRNLIGDMAKRCQE 321 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 3.6 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 328 WLFSIPNLLKLCVIFLVSDKLY 263 W+F+I +L C+I L + LY Sbjct: 508 WIFTIACVLGTCLIILQAPSLY 529 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 230 NGYANCVRRNFVQFIAYQKYNTKFKQVWN 316 N YANC + Q Y KF Q N Sbjct: 90 NAYANCANEPYCAARTVQGYMRKFGQDCN 118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,222 Number of Sequences: 2352 Number of extensions: 9820 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -