BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E11f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g34412.1 68417.m04888 expressed protein 47 9e-06 At2g40990.1 68415.m05063 zinc finger (DHHC type) family protein ... 29 2.5 At5g18310.2 68418.m02155 expressed protein predicted proteins, D... 27 5.8 At5g18310.1 68418.m02154 expressed protein predicted proteins, D... 27 5.8 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 27 5.8 At1g43245.1 68414.m04985 expressed protein 27 7.7 >At4g34412.1 68417.m04888 expressed protein Length = 143 Score = 46.8 bits (106), Expect = 9e-06 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 2/98 (2%) Frame = +3 Query: 39 VLDPETKTTLKIYLYKNVQNIEEIRNHITNGEWNCAI--IKPSLILDPFQXXXXXXXXXX 212 V + + TL + L+ V N +E+ N + +G + + SLI D F Sbjct: 3 VFNLDRGNTLSVSLFSGVTNSKELLNSMLDGSLKLEVSFLNASLIPDIFPLLAAAQKALI 62 Query: 213 XXKFSTMVTRTVFGEILYNLSLTKNITQSLSKFGIEKS 326 ++ TRT+ E++YN S +K+IT+SL + GI ++ Sbjct: 63 SKSRDSLSTRTLHSELVYNYSGSKHITESLKRCGISEN 100 >At2g40990.1 68415.m05063 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 386 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -1 Query: 236 NHCTKFRCDNCSVRRHSHLKWI*DQARLNNCTVPLAVCNVIPNFLDVLHIFV 81 +HC+ C+NC R H W+ L N P +C + + L L++FV Sbjct: 149 SHCSI--CNNCVQRFDHHCPWVGQCIALRN--YPYFICFISTSTLLCLYVFV 196 >At5g18310.2 68418.m02155 expressed protein predicted proteins, Drosophila melanogaster Length = 167 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 207 LLCSPPQPLEMDLRSS*A**LHSSTRR 127 L C PP+P++ DL +HSSTR+ Sbjct: 128 LTCKPPKPVDEDLYKIPPEFIHSSTRK 154 >At5g18310.1 68418.m02154 expressed protein predicted proteins, Drosophila melanogaster Length = 139 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 207 LLCSPPQPLEMDLRSS*A**LHSSTRR 127 L C PP+P++ DL +HSSTR+ Sbjct: 100 LTCKPPKPVDEDLYKIPPEFIHSSTRK 126 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 39 VLDPETKTTLKIYLYKNVQNIEEIRNHI 122 +LDP T TL+IY +N+ E++ + I Sbjct: 343 MLDPSTSRTLRIYPLENITRCEKLDSSI 370 >At1g43245.1 68414.m04985 expressed protein Length = 558 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 Query: 354 TNEIDCRPEILPEIKGEQCSITELCNFTNLKDVKSVYKLNNLKSDEGLL 500 TN PEI P + + + L N T + S ++LNNL ++ LL Sbjct: 63 TNSPQFPPEITPILPSDIRTSLHLLNSTAVDTSSSPHRLNNLLTNHHLL 111 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,505,790 Number of Sequences: 28952 Number of extensions: 201376 Number of successful extensions: 561 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -