BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E08f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66720.2 68418.m08411 5-azacytidine resistance protein -relat... 27 7.7 At5g66720.1 68418.m08410 5-azacytidine resistance protein -relat... 27 7.7 >At5g66720.2 68418.m08411 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 411 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 351 FHKIXIXKNSIFFQFXGRKIYHFSXTIFRXKLGIPGGFPVFPDS 220 F +I K+ FF G++ + FR + G PVF D+ Sbjct: 17 FQRIVAGKSKSFFSNSGQRRLFSDSSRFRQAMAASGSLPVFGDA 60 >At5g66720.1 68418.m08410 5-azacytidine resistance protein -related contains weak similarity to 5-azacytidine resistance protein azr1 (Swiss-Prot:Q09189) [Schizosaccharomyces pombe] Length = 414 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -3 Query: 351 FHKIXIXKNSIFFQFXGRKIYHFSXTIFRXKLGIPGGFPVFPDS 220 F +I K+ FF G++ + FR + G PVF D+ Sbjct: 17 FQRIVAGKSKSFFSNSGQRRLFSDSSRFRQAMAASGSLPVFGDA 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,826,678 Number of Sequences: 28952 Number of extensions: 150776 Number of successful extensions: 271 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -