BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E07f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 26 0.18 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 24 0.94 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 26.2 bits (55), Expect = 0.18 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +2 Query: 323 YKVEDPHTGDNKYQHETRDGDVVKGVYSLHEADGTVRTVEYSAD 454 Y VE + + + T DG +V + DG++R V Y+AD Sbjct: 195 YVVEGRNYRKYRVEERTSDGFIVGEYGVVSHDDGSLRGVRYTAD 238 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 23.8 bits (49), Expect = 0.94 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +3 Query: 30 FWPQSRLDLKRAMAMEDTTTAMRFHPKASYYTRVTDMNISHITLQPT 170 FW QS LDL R + F P+ S + R T + T + T Sbjct: 450 FWQQSDLDLSR---------GLDFQPRGSVFVRFTHLQNQDFTYKIT 487 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,936 Number of Sequences: 336 Number of extensions: 1833 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -