BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 24 3.6 AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha su... 23 4.7 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -2 Query: 160 KLHQLLIL*NALCDLKGSLSSVWSVRCFLNPLLM 59 KLH IL N LK S + F+NP+ + Sbjct: 47 KLHMSAILQNCYKQLKSSGQPFGGIHFFINPVAL 80 >AY724802-1|AAW50311.1| 134|Anopheles gambiae G protein alpha subunit AgOn protein. Length = 134 Score = 23.4 bits (48), Expect = 4.7 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +1 Query: 100 SSKILSNHKEHFTKLAVDAVLRLKGSGNLKAIQIIKISGGLLEESFLDEGF 252 S +I N KE + A D L L G+G I+K + E F E F Sbjct: 3 SKQIERNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTSEDF 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.131 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 502,505 Number of Sequences: 2352 Number of extensions: 9680 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -