BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS313E03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 3.3 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 4.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 4.4 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 5.8 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 7.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 7.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 7.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.7 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 260 FSKNPSSKNDSSRRPPDILII 198 FSKNP + N + PP L++ Sbjct: 513 FSKNPVTVNLTKLHPPADLVV 533 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 188 KLFKLSKYLEVFLKNHSWMKGSC*TKKLVY 277 KLF +K ++F K W K + + +Y Sbjct: 113 KLFYHAKDFDIFFKTALWAKNNINEAQYIY 142 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 4.4 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 188 KLFKLSKYLEVFLKNHSWMKGSC*TKKLVY 277 KLF +K ++F K W K + + +Y Sbjct: 113 KLFYHAKDFDIFFKTALWAKNNINEAQYIY 142 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +2 Query: 260 TKKLVYINQRK*KMLTSLLQTHQWTL 337 T+ L+Y +R+ K L L+ W L Sbjct: 141 TQPLIYSRRRRSKRLAGLMIVAVWVL 166 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -3 Query: 318 CNKDVSIFYFLWLMYTN 268 C D +++ WL Y N Sbjct: 357 CPSDRMVYFITWLGYVN 373 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -3 Query: 318 CNKDVSIFYFLWLMYTN 268 C D +++ WL Y N Sbjct: 357 CPSDRMVYFITWLGYVN 373 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = -3 Query: 318 CNKDVSIFYFLWLMYTN 268 C D +++ WL Y N Sbjct: 357 CPSDRMVYFITWLGYVN 373 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 227 KNHSWMKGSC*TKKLVYINQRK*KMLTSLLQ 319 K W++G T +L+Y Q K L +LQ Sbjct: 995 KEPPWLEGVHVTPELIYEYQIHPKTLNEVLQ 1025 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.315 0.131 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,560 Number of Sequences: 438 Number of extensions: 2664 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -